Potri.005G239000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18420 117 / 5e-36 Gibberellin-regulated family protein (.1)
AT1G75750 105 / 5e-31 GASA1 GAST1 protein homolog 1 (.1.2)
AT4G09600 87 / 9e-24 GASA3 GAST1 protein homolog 3 (.1)
AT1G22690 87 / 2e-23 Gibberellin-regulated family protein (.1.2.3)
AT5G14920 73 / 1e-16 Gibberellin-regulated family protein (.1.2)
AT5G59845 67 / 5e-16 Gibberellin-regulated family protein (.1)
AT1G74670 66 / 3e-15 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT4G09610 64 / 7e-15 GASA2 GAST1 protein homolog 2 (.1)
AT1G10588 63 / 2e-14 Gibberellin-regulated family protein (.1.2)
AT2G39540 62 / 3e-14 Gibberellin-regulated family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G239100 117 / 9e-36 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022600 111 / 2e-33 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022500 109 / 2e-32 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.013G113400 96 / 1e-27 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Potri.002G022700 96 / 3e-27 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Potri.012G076700 89 / 2e-24 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.015G071500 86 / 2e-23 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2)
Potri.019G083900 82 / 1e-21 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.014G020100 70 / 5e-17 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017212 111 / 2e-33 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10025962 97 / 2e-27 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10034524 94 / 2e-26 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10014262 92 / 3e-25 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1)
Lus10033145 86 / 2e-23 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10024338 83 / 4e-22 ND 78 / 3e-20
Lus10009421 85 / 7e-22 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10021098 80 / 7e-21 AT2G18420 77 / 8e-20 Gibberellin-regulated family protein (.1)
Lus10039443 72 / 7e-17 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2)
Lus10018708 64 / 1e-14 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Potri.005G239000.2 pacid=42805174 polypeptide=Potri.005G239000.2.p locus=Potri.005G239000 ID=Potri.005G239000.2.v4.1 annot-version=v4.1
ATGGCCATCTTCAAGACTCTAGCTGCTGTCCTCCTTGTAGGAATCGTCTTCAGCCTTGCTGTATCTGATATGGTGATCAAGAGCTTGGTGGAGAGTGACC
CAGCCCCGCAGATAGACTGTGCTTCGGCTTGTGCTGTGAGGTGCCAATTGTCGTCAAGGCCAAACCTATGCCACCGAGCGTGTGGTACCTGCTGTGCTCG
TTGCAACTGCGTTCCTCCGGGCACTTCTGGCAACTATGACGTGTGTCCCTGCTATGGCAACATGACAACTCACCATGGCCAGCACAAGTGCCCTTGA
AA sequence
>Potri.005G239000.2 pacid=42805174 polypeptide=Potri.005G239000.2.p locus=Potri.005G239000 ID=Potri.005G239000.2.v4.1 annot-version=v4.1
MAIFKTLAAVLLVGIVFSLAVSDMVIKSLVESDPAPQIDCASACAVRCQLSSRPNLCHRACGTCCARCNCVPPGTSGNYDVCPCYGNMTTHHGQHKCP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G18420 Gibberellin-regulated family p... Potri.005G239000 0 1
AT5G28910 unknown protein Potri.019G019800 2.00 0.8598
AT5G07800 Flavin-binding monooxygenase f... Potri.012G067500 5.47 0.7941
AT5G01930 MAN6, AtMAN6 endo-beta-mannase 6, Glycosyl ... Potri.016G138600 7.54 0.8050
AT3G23200 Uncharacterised protein family... Potri.010G073000 10.67 0.7483
AT1G20850 XCP2 xylem cysteine peptidase 2 (.1... Potri.005G256000 15.19 0.7888 XCP2.1
AT4G37850 bHLH bHLH025 basic helix-loop-helix (bHLH) ... Potri.001G287200 15.74 0.6739
AT3G48260 WNK3 with no lysine (K) kinase 3 (.... Potri.012G086700 18.41 0.6809 WNK3.2
AT5G50870 UBC27 ubiquitin-conjugating enzyme 2... Potri.015G103400 18.54 0.7777
AT5G44740 POLH Y-family DNA polymerase H (.1.... Potri.003G152600 19.28 0.8027
AT2G32940 AGO6 ARGONAUTE 6, Argonaute family ... Potri.014G159400 25.92 0.7310 AGO902

Potri.005G239000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.