Pt-GASA1.2 (Potri.005G239100) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-GASA1.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75750 112 / 9e-34 GASA1 GAST1 protein homolog 1 (.1.2)
AT2G18420 111 / 2e-33 Gibberellin-regulated family protein (.1)
AT4G09600 93 / 4e-26 GASA3 GAST1 protein homolog 3 (.1)
AT1G22690 86 / 4e-23 Gibberellin-regulated family protein (.1.2.3)
AT4G09610 74 / 9e-19 GASA2 GAST1 protein homolog 2 (.1)
AT5G14920 71 / 7e-16 Gibberellin-regulated family protein (.1.2)
AT2G39540 57 / 5e-12 Gibberellin-regulated family protein (.1)
AT5G59845 56 / 9e-12 Gibberellin-regulated family protein (.1)
AT1G74670 57 / 1e-11 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT1G10588 55 / 4e-11 Gibberellin-regulated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G022600 158 / 9e-52 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022700 115 / 4e-35 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Potri.005G239000 112 / 6e-34 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Potri.002G022500 110 / 1e-32 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.013G113400 94 / 2e-26 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Potri.019G083900 87 / 1e-23 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.012G076700 86 / 3e-23 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.015G071500 84 / 1e-22 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2)
Potri.001G350600 71 / 6e-16 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017212 110 / 4e-33 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10034524 97 / 3e-27 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10033145 86 / 2e-23 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10014262 86 / 9e-23 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1)
Lus10024338 85 / 1e-22 ND 78 / 3e-20
Lus10009421 86 / 4e-22 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10025962 83 / 8e-22 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10021098 74 / 2e-18 AT2G18420 77 / 8e-20 Gibberellin-regulated family protein (.1)
Lus10039443 66 / 1e-14 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2)
Lus10001407 59 / 2e-12 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Potri.005G239100.2 pacid=42805403 polypeptide=Potri.005G239100.2.p locus=Potri.005G239100 ID=Potri.005G239100.2.v4.1 annot-version=v4.1
ATGGCTATGATCACCAAGTTTCTGATTGCTTTACTTTTCTTCTCTCTTCTTGTTCTCCATCTTGCCGAGGCTGATCATGATACAGTGAACTCAAATCTGG
CTGCGAGTTCCCCTCCTACGAAAATTGATTGTGGTAGCGCTTGCGAGGCGAGGTGCCAGTTATCATCTAGGCCACGCCTGTGCAAGAGAGCATGTGGGAC
TTGCTGTTCAAGATGCAGCTGTGTGCCTCCAGGAACGGCCGGTAACTATGACGCTTGCCCCTGCTACGCCAGCTTGACTACCCATGGCGGCAGACGCAAG
TGTCCTTGA
AA sequence
>Potri.005G239100.2 pacid=42805403 polypeptide=Potri.005G239100.2.p locus=Potri.005G239100 ID=Potri.005G239100.2.v4.1 annot-version=v4.1
MAMITKFLIALLFFSLLVLHLAEADHDTVNSNLAASSPPTKIDCGSACEARCQLSSRPRLCKRACGTCCSRCSCVPPGTAGNYDACPCYASLTTHGGRRK
CP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G75750 GASA1 GAST1 protein homolog 1 (.1.2) Potri.005G239100 0 1 Pt-GASA1.2
Potri.011G153800 4.89 0.7947
AT1G63860 Disease resistance protein (TI... Potri.019G097720 6.32 0.8282
AT5G38280 PR5K PR5-like receptor kinase (.1) Potri.015G122000 14.00 0.7971
AT3G18670 Ankyrin repeat family protein ... Potri.011G015750 14.07 0.7915
AT1G02860 BAH1, NLA nitrogen limitation adaptation... Potri.002G205400 15.87 0.7836
AT5G46470 RPS6 RESISTANT TO P. SYRINGAE 6, di... Potri.019G097640 16.73 0.7996
AT1G70210 ATCYCD1;1, CYCD... CYCLIN D1;1 (.1) Potri.007G005700 18.97 0.7369
AT4G39070 CO B-box zinc finger family prote... Potri.009G122000 19.07 0.7876
AT5G17680 disease resistance protein (TI... Potri.019G098700 19.74 0.7978
AT1G65790 ARK1 receptor kinase 1 (.1) Potri.004G024316 20.34 0.7514

Potri.005G239100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.