Potri.005G239150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G014250 103 / 5e-29 AT3G47680 87 / 6e-21 DNA binding (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF14303 NAM-associated No apical meristem-associated C-terminal domain
Representative CDS sequence
>Potri.005G239150.1 pacid=42802695 polypeptide=Potri.005G239150.1.p locus=Potri.005G239150 ID=Potri.005G239150.1.v4.1 annot-version=v4.1
ATGACCGAAGAATCAAGGATTAATGATGCTCGGCAAATGTATGCTTCTTGCGTTGGCAAACGATTTCAACTAGAACATTGTTGGGTTATCTTAAGAAAAG
AACCCAAATGGCAATTTGAGCGTGCAAGTCAACATCAAAGGTCAAACAAGAAACAAAAAGGTCATGTCAATGCAAGTCCGGCTTCATCAACTCCATCTAC
CCCTGATTCTGTTAGTTTAGGAGAAGATAGTGAACCATTGATTTATCAAGATAGACCAATCGGTCAGAAGGCTGCAAATGAACGATTTAAACGTAGACAA
GGAAGAGATAAAGTTGGGGATGTAACTGTAACGAATCTCTTACAACAATTCAGGGATACTCTAGTTGAAATTGAGGATTAG
AA sequence
>Potri.005G239150.1 pacid=42802695 polypeptide=Potri.005G239150.1.p locus=Potri.005G239150 ID=Potri.005G239150.1.v4.1 annot-version=v4.1
MTEESRINDARQMYASCVGKRFQLEHCWVILRKEPKWQFERASQHQRSNKKQKGHVNASPASSTPSTPDSVSLGEDSEPLIYQDRPIGQKAANERFKRRQ
GRDKVGDVTVTNLLQQFRDTLVEIED

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G239150 0 1
Potri.001G165360 12.16 0.6829
Potri.011G014701 17.02 0.7520
AT5G47550 Cystatin/monellin superfamily ... Potri.006G014600 35.32 0.6252
AT1G03050 ENTH/ANTH/VHS superfamily prot... Potri.006G118100 99.37 0.6471
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Potri.004G174150 100.11 0.6698
AT4G03130 BRCT domain-containing DNA rep... Potri.002G214050 222.85 0.6231

Potri.005G239150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.