Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1) AT4G36040 102 / 5e-28 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) AT3G13310 78 / 2e-18 Chaperone DnaJ-domain superfamily protein (.1) AT4G13830 77 / 4e-18 J20 DNAJ-like 20 (.1.2) AT4G39960 66 / 6e-13 Molecular chaperone Hsp40/DnaJ family protein (.1) AT3G47940 63 / 7e-12 DNAJ heat shock family protein (.1) AT2G22360 62 / 2e-11 DNAJ heat shock family protein (.1) AT4G37480 61 / 3e-11 Chaperone DnaJ-domain superfamily protein (.1) AT3G17830 61 / 5e-11 Molecular chaperone Hsp40/DnaJ family protein (.1) AT5G01390 59 / 8e-11 DNAJ heat shock family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G020800 [exp] 240 / 5e-82 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G020700 [exp] 222 / 5e-75 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1) Potri.004G172300 [exp] 122 / 1e-35 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G113100 [exp] 120 / 3e-35 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1) Potri.009G131800 [exp] 110 / 1e-31 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1) Potri.001G469600 [exp] 89 / 9e-23 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1) Potri.011G166500 [exp] 83 / 3e-20 AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.007G107600 [exp] 81 / 6e-20 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.001G319100 [exp] 78 / 4e-18 AT4G13830 157 / 8e-49 DNAJ-like 20 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017263 [exp] 167 / 2e-53 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10041906 [exp] 115 / 6e-33 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10013558 [exp] 111 / 2e-32 AT4G36040 82 / 1e-21 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10028453 [exp] 111 / 2e-31 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1) Lus10034484 [exp] 99 / 4e-27 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10025060 [exp] 92 / 3e-24 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10002355 [exp] 87 / 3e-21 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2) Lus10032957 [exp] 84 / 5e-21 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1) Lus10003150 [exp] 84 / 4e-20 AT4G13830 151 / 3e-46 DNAJ-like 20 (.1.2) Lus10002356 [exp] 79 / 1e-18 AT4G13830 144 / 1e-43 DNAJ-like 20 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [poplar] [flax] Chaperone-J PF00226 [poplar] [flax] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Potri.005G240700.1 pacid=42804349 polypeptide=Potri.005G240700.1.p locus=Potri.005G240700 ID=Potri.005G240700.1.v4.1 annot-version=v4.1 ATGGCCACCACATCTTCTCTTGCATCTCTTAGCTCCTCCATATCCCCTTTCACTGGCTCAAAAACCTCCACCAATCAGCCTCATACATCACCATCTCGTG TCAGCTTCCGCCCTTTTCGAGTACGCGCCGCCTGCGCTACCACCGCCGAGAGACCCACATCATACACTGCGACACCAACATCAGCATCGTCTCTCTACGA AGTTCTTGGGATTCAAATGGGTGCCACGTGTACAGAGATCAAGACTGCTTATCGAAGACTAGCAAGAGTTTTGCATCCTGATGTTGCAGCTAACGGTAGA AGGGAGGACACCGCTTATGAGTTCATAAGAGTCCATGAAGCTTACGAAACTCTGTCCGATCCTGAAAAACGGGCAGATTATGATCGCTCCCTTTACAGAC GAGGAAGGCAAATGAGCTCTCCGTTTGTAATGTCCGCTGCTACTGCAACAACAATGGCAACAGGTTATGCAGCTGCTGGATTTTCTGGCTATACAAGGCG GAGATGGGAAACTGATCAGTGCTGGTAG
AA sequence Show only first row Show all	>Potri.005G240700.1 pacid=42804349 polypeptide=Potri.005G240700.1.p locus=Potri.005G240700 ID=Potri.005G240700.1.v4.1 annot-version=v4.1 MATTSSLASLSSSISPFTGSKTSTNQPHTSPSRVSFRPFRVRAACATTAERPTSYTATPTSASSLYEVLGIQMGATCTEIKTAYRRLARVLHPDVAANGR REDTAYEFIRVHEAYETLSDPEKRADYDRSLYRRGRQMSSPFVMSAATATTMATGYAAAGFSGYTRRRWETDQCW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G17880			Chaperone DnaJ-domain superfam...		Potri.005G240700 [exp]	0	1
AT2G17880			Chaperone DnaJ-domain superfam...		Potri.004G172300 [exp]	1.00	0.8945
AT1G08570		ACHT4	atypical CYS HIS rich thiored...		Potri.019G031900 [exp]	1.41	0.8936
AT1G25400			unknown protein		Potri.008G121700 [exp]	6.70	0.8140
AT3G45890		RUS1	ROOT UVB SENSITIVE 1, Protein ...		Potri.001G193300 [exp]	8.12	0.8322
AT5G65780		ATBCAT-5	branched-chain amino acid amin...		Potri.007G008000 [exp]	19.28	0.7229
AT5G45040		CYTC6A	cytochrome c6A, Cytochrome c (...		Potri.015G121101 [exp]	19.69	0.8195
AT1G05805	bHLH	bHLH128	basic helix-loop-helix (bHLH) ...		Potri.014G150600 [exp]	28.28	0.7885
AT5G22510		INV-E, At-A/N-I...	Arabidopsis alkaline/neutral i...		Potri.008G024100 [exp]	28.93	0.7935
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Potri.002G120600 [exp]	30.74	0.7653
AT1G24440			RING/U-box superfamily protein...		Potri.008G181300 [exp]	32.00	0.7440

Compare expression of checked genes

Potri.005G240700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.