Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-SKP1.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75950 244 / 2e-84 UIP1, SKP1A, ATSKP1, ASK1, SKP1 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) AT5G42190 244 / 5e-84 SKP1B, ASK2 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) AT1G20140 223 / 1e-75 ASK4 SKP1-like 4 (.1) AT2G25700 212 / 2e-71 ASK3 SKP1-like 3 (.1) AT4G34210 205 / 7e-69 ASK11 SKP1-like 11 (.1) AT4G34470 201 / 3e-67 ASK12 SKP1-like 12 (.1) AT3G60010 192 / 2e-63 ASK13 SKP1-like 13 (.1) AT3G21860 182 / 9e-60 ASK10 SKP1-like 10 (.1) AT3G21850 181 / 2e-59 ASK9 SKP1-like 9 (.1) AT2G03170 175 / 5e-57 ASK14 SKP1-like 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G018700 [exp] 281 / 1e-98 AT5G42190 249 / 6e-86 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.005G109900 [exp] 266 / 1e-92 AT5G42190 249 / 5e-86 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.004G175900 [exp] 240 / 1e-82 AT5G42190 245 / 2e-84 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.009G135800 [exp] 233 / 1e-79 AT1G20140 215 / 9e-73 SKP1-like 4 (.1) Potri.012G085200 [exp] 150 / 4e-47 AT4G34210 157 / 7e-50 SKP1-like 11 (.1) Potri.001G132300 [exp] 126 / 8e-38 AT1G75950 122 / 3e-36 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Potri.012G086900 [exp] 123 / 1e-36 AT4G34210 130 / 1e-39 SKP1-like 11 (.1) Potri.005G094800 [exp] 111 / 2e-31 AT3G21860 114 / 2e-32 SKP1-like 10 (.1) Potri.016G028300 [exp] 77 / 4e-18 AT2G03170 79 / 6e-19 SKP1-like 14 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017282 [exp] 269 / 5e-94 AT5G42190 259 / 6e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Lus10005610 [exp] 268 / 1e-93 AT5G42190 261 / 2e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Lus10017281 [exp] 268 / 2e-93 AT5G42190 259 / 4e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Lus10013575 [exp] 266 / 7e-93 AT1G75950 255 / 2e-88 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Lus10019794 [exp] 251 / 9e-87 AT1G75950 241 / 8e-83 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Lus10014115 [exp] 248 / 1e-79 AT1G68010 700 / 0.0 hydroxypyruvate reductase (.1.2) Lus10041874 [exp] 218 / 8e-74 AT4G34210 201 / 3e-67 SKP1-like 11 (.1) Lus10019432 [exp] 191 / 3e-63 AT1G20140 186 / 2e-61 SKP1-like 4 (.1) Lus10002803 [exp] 168 / 6e-54 AT1G20140 189 / 3e-62 SKP1-like 4 (.1) Lus10031747 [exp] 95 / 7e-25 AT2G03190 104 / 7e-29 SKP1-like 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01466 [poplar] [flax] Skp1 Skp1 family, dimerisation domain CL0033 [poplar] [flax] POZ PF03931 [poplar] [flax] Skp1_POZ Skp1 family, tetramerisation domain
Representative CDS sequence Show only first row Show all	>Potri.005G243100.2 pacid=42803139 polypeptide=Potri.005G243100.2.p locus=Potri.005G243100 ID=Potri.005G243100.2.v4.1 annot-version=v4.1 ATGTCGACGGGCCGGAAATTTATTCTGAAAAGCTCAGACGGAGAGTCATTTGAGGTCGACGAAGCCGTAGCCGTTGAATCTCAGACTATAAAACACATGA TTGAAGATGACTGCGCTGATAACGGTATCCCTTTACCTAACGTTACAAGCAAGGTTCTTGCTAAGGTGATCGAGTACTGCAAAAAGCACGTTGAGTCCCC TAAATCGGACGATCGTCCTTCTTCTGCTGCTGATGATCTTAAAGCTTGGGATGCTGAATTCGTCAAAGTTGACCAGGCCACTCTCTTCGATCTCATCCTG GCTGCCAATTATCTGAACATCAAGAACTTGCTGGACCTCACTTGTCAGAGAGTGGCTGATATGATCAAGGGCAAGACTCCAGAAGAGATCCGCAAGACAT TCAACATCAAGAATGACTTTACACCAGAGGAAGAGGAGGAGGTTCGGAGAGAGAACCAGTGGGCATTTGAGTAG
AA sequence Show only first row Show all	>Potri.005G243100.2 pacid=42803139 polypeptide=Potri.005G243100.2.p locus=Potri.005G243100 ID=Potri.005G243100.2.v4.1 annot-version=v4.1 MSTGRKFILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTSKVLAKVIEYCKKHVESPKSDDRPSSAADDLKAWDAEFVKVDQATLFDLIL AANYLNIKNLLDLTCQRVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75950		UIP1, SKP1A, AT...	UFO INTERACTING PROTEIN 1, ARA...		Potri.005G243100 [exp]	0	1	Pt-SKP1.3
AT3G58680		MBF1B, ATMBF1B	multiprotein bridging factor 1...		Potri.011G109500 [exp]	1.41	0.7622
AT4G35980			unknown protein		Potri.005G111900 [exp]	9.48	0.7127
AT5G24165			unknown protein		Potri.012G011600 [exp]	12.00	0.7744
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Potri.001G250400 [exp]	13.22	0.6735	Pt-ATPH1.2
AT1G25420			Regulator of Vps4 activity in ...		Potri.008G121300 [exp]	13.74	0.6717
AT3G55600			Membrane fusion protein Use1 (...		Potri.018G133700 [exp]	14.31	0.6595
AT4G29160		SNF7.1	SNF7 family protein (.1.2.3)		Potri.018G069900 [exp]	20.14	0.6900
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Potri.014G153800 [exp]	21.56	0.6894
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Potri.015G139800 [exp]	22.49	0.6575	MP2.3
AT3G05070			unknown protein		Potri.004G067300 [exp]	23.23	0.7592

Compare expression of checked genes

Potri.005G243100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.