Potri.005G244800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35840 132 / 3e-38 RING/U-box superfamily protein (.1)
AT5G66070 132 / 5e-38 RING/U-box superfamily protein (.1.2)
AT2G17730 130 / 2e-37 NIP2 NEP-interacting protein 2 (.1.2)
AT1G74410 81 / 2e-18 RING/U-box superfamily protein (.1)
AT3G20395 71 / 6e-15 RING/U-box superfamily protein (.1)
AT1G21960 61 / 3e-11 RING/U-box superfamily protein (.1)
AT3G10910 60 / 4e-11 RING/U-box superfamily protein (.1)
AT5G05280 60 / 4e-11 RING/U-box superfamily protein (.1)
AT3G16720 61 / 1e-10 ATL2 TOXICOS EN LEVADURA 2 (.1)
AT2G25409 58 / 1e-10 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G108200 141 / 2e-41 AT4G35840 369 / 7e-131 RING/U-box superfamily protein (.1)
Potri.007G061400 124 / 6e-35 AT2G17730 351 / 8e-124 NEP-interacting protein 2 (.1.2)
Potri.001G435800 70 / 2e-14 AT3G20395 153 / 4e-46 RING/U-box superfamily protein (.1)
Potri.005G244900 68 / 3e-14 AT5G66070 79 / 1e-18 RING/U-box superfamily protein (.1.2)
Potri.013G157000 62 / 6e-12 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1)
Potri.016G136200 62 / 6e-12 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1)
Potri.010G245801 62 / 8e-12 AT2G27940 61 / 1e-11 RING/U-box superfamily protein (.1)
Potri.019G057700 60 / 5e-11 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.006G144200 59 / 1e-10 AT5G17600 90 / 3e-21 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028406 144 / 2e-42 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10041859 144 / 2e-42 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10021524 76 / 2e-16 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1)
Lus10001654 70 / 2e-14 AT1G74410 251 / 1e-84 RING/U-box superfamily protein (.1)
Lus10024405 64 / 1e-12 AT4G17905 95 / 9e-24 RING/U-box superfamily protein (.1)
Lus10021628 62 / 1e-11 AT1G74410 250 / 5e-84 RING/U-box superfamily protein (.1)
Lus10025338 61 / 2e-11 AT4G17905 99 / 4e-25 RING/U-box superfamily protein (.1)
Lus10029037 60 / 5e-11 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1)
Lus10020859 60 / 1e-10 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1)
Lus10005815 59 / 2e-10 AT1G49230 170 / 3e-53 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.005G244800.2 pacid=42803949 polypeptide=Potri.005G244800.2.p locus=Potri.005G244800 ID=Potri.005G244800.2.v4.1 annot-version=v4.1
ATGTCCGGTGGCCTTGTTACTAGTTTAATCGCTAGACATAAGCTCATGAAGATCGTATACAACTGCCCATCATCTTGCTCTGCTTCTTCTTTAGCGTTTT
GGGTTTCTGCCAAGGTTTATGCAATTGCGTGCAAGCTATTCTGTGCGATCTTGACGTTCGTGTTTGCAGTAGCTGGCACAACATTGGGAGCCTATGCTGG
AGCAGTTGTGGGCCTAAAGTCTAAAAGTAGCTTACTTCATGGAGCCGCAGTTGGAGCCATCATGGGGTGCATACTTTCCTTTGAAATTTTTAGAAAATCA
TTCGTTCTCTGGGATTCTGATGATTGGGCAATTGACACCTTCATTCATTTCATTCAAACAGGTTCAAACATCTTGAATGAAAGAATAGAAAGGCTTAGTT
CAACCACAATTTGCAGCAATGGATTATCGATGCTGAAAATTCAAAATAAGAGACTTGCAAACAAAAACTTTGTGGATACCTTATGGAATGGACCTTCCTG
CCCAATCTGCCTACAGGACTTCCAACTGGGGGAAATGGTTTGCAGCTTGCCGGGGTGCCGCCACACATTTCATCCACGTTGTATTGGTCAGTGGTTTATT
GGACACAGTTCTTGCCCATTTTGCAGGGAAATACCATTTTTGGTGGAGAATGTGGATTGTGCTAGTTAA
AA sequence
>Potri.005G244800.2 pacid=42803949 polypeptide=Potri.005G244800.2.p locus=Potri.005G244800 ID=Potri.005G244800.2.v4.1 annot-version=v4.1
MSGGLVTSLIARHKLMKIVYNCPSSCSASSLAFWVSAKVYAIACKLFCAILTFVFAVAGTTLGAYAGAVVGLKSKSSLLHGAAVGAIMGCILSFEIFRKS
FVLWDSDDWAIDTFIHFIQTGSNILNERIERLSSTTICSNGLSMLKIQNKRLANKNFVDTLWNGPSCPICLQDFQLGEMVCSLPGCRHTFHPRCIGQWFI
GHSSCPFCREIPFLVENVDCAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G35840 RING/U-box superfamily protein... Potri.005G244800 0 1
Potri.012G121504 3.46 0.8947
AT2G17040 NAC ANAC036 NAC domain containing protein ... Potri.005G103200 5.29 0.8946
AT5G40010 ASD, AATP1 ATPase-in-Seed-Development, AA... Potri.004G012700 6.16 0.9085
AT5G40010 ASD, AATP1 ATPase-in-Seed-Development, AA... Potri.004G012601 6.48 0.9081
AT5G64810 WRKY ATWRKY51, WRKY5... ARABIDOPSIS THALIANA WRKY DNA-... Potri.005G085200 9.48 0.8648 WRKY51.1
AT3G46400 Leucine-rich repeat protein ki... Potri.012G002900 9.79 0.8899
AT3G50940 P-loop containing nucleoside t... Potri.011G111200 10.48 0.8065
AT3G48090 ATEDS1, EDS1 enhanced disease susceptibilit... Potri.015G069600 11.40 0.8965 EDS1.2
Potri.001G078000 12.00 0.8728
Potri.019G110602 12.64 0.8528

Potri.005G244800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.