Potri.005G244900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66070 80 / 9e-19 RING/U-box superfamily protein (.1.2)
AT2G17730 79 / 3e-18 NIP2 NEP-interacting protein 2 (.1.2)
AT4G35840 75 / 6e-17 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G108200 81 / 3e-19 AT4G35840 369 / 7e-131 RING/U-box superfamily protein (.1)
Potri.007G061400 74 / 2e-16 AT2G17730 351 / 8e-124 NEP-interacting protein 2 (.1.2)
Potri.005G244800 67 / 4e-14 AT4G35840 132 / 3e-38 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028406 81 / 3e-19 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10041859 81 / 3e-19 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10021524 45 / 3e-06 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1)
Lus10040073 45 / 5e-06 AT3G20395 94 / 5e-24 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.005G244900.2 pacid=42803263 polypeptide=Potri.005G244900.2.p locus=Potri.005G244900 ID=Potri.005G244900.2.v4.1 annot-version=v4.1
ATGAAGATTTGCGCTTGTCCTCCTCCTCCTCCAACTCCCCGTTCTTCTCTTGTATCGACTGTTTCTTCTGTAAGTTTGAGGGAGCCATGCATCTCTATTC
TGTCCACTATAATTGCCAAGTTGACCTGTGCAATTCTGACTCTCTTATCTGCAGAAGTGGGTGCAACATTGGGAGTCCTGATAGGAGCTTTTGCTGGCCT
GAAAACGGAGAAGGGGTTTCTCCATGGAGCCATAACTGGAGCGGCAAATGGGGTTATTTTATCCAAAAAGATCCTTGAAATATTACTTGCTACGTGGGAT
TCTGATGATACAGTAATCGCATGCTTCTTTTCTCTGCTTGACTCAGTTGCATGTATCATGAGTAGAAGACACCATCCTCAACGATTCAATCCAACCAAAA
TAGATGCAGAAGAGAGTGAGGTTGATATTGTCGTCCTCGTCCATGCAACCTACAAGCTGATATGA
AA sequence
>Potri.005G244900.2 pacid=42803263 polypeptide=Potri.005G244900.2.p locus=Potri.005G244900 ID=Potri.005G244900.2.v4.1 annot-version=v4.1
MKICACPPPPPTPRSSLVSTVSSVSLREPCISILSTIIAKLTCAILTLLSAEVGATLGVLIGAFAGLKTEKGFLHGAITGAANGVILSKKILEILLATWD
SDDTVIACFFSLLDSVACIMSRRHHPQRFNPTKIDAEESEVDIVVLVHATYKLI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G66070 RING/U-box superfamily protein... Potri.005G244900 0 1
AT5G67500 VDAC2, ATVDAC2 ARABIDOPSIS THALIANA VOLTAGE D... Potri.001G294100 2.23 0.9462
AT1G76520 Auxin efflux carrier family pr... Potri.001G125501 4.24 0.8616
Potri.014G069900 8.66 0.8904
AT5G13930 ATCHS, TT4, CHS TRANSPARENT TESTA 4, CHALCONE ... Potri.001G028600 12.24 0.8867
Potri.012G120768 13.49 0.8856
Potri.012G121044 16.88 0.8881
Potri.019G109501 19.05 0.8767
AT2G45560 CYP76C1 "cytochrome P450, family 76, s... Potri.012G136600 24.65 0.8836 CYP80D1
AT4G14860 OFP ATOFP11 ovate family protein 11 (.1) Potri.010G087200 26.98 0.8716
Potri.012G120952 27.96 0.8624

Potri.005G244900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.