Plant FIBer expression Database

Potri.005G252701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02930 52 / 6e-08 F-box/RNI-like superfamily protein (.1)
AT3G58900 47 / 2e-06 F-box/RNI-like superfamily protein (.1.2.3.4)
AT5G02920 45 / 7e-06 F-box/RNI-like superfamily protein (.1)
AT5G53635 44 / 3e-05 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT5G35995 43 / 6e-05 F-box/RNI-like superfamily protein (.1.2)
AT5G38396 42 / 0.0002 F-box/RNI-like superfamily protein (.1)
AT4G13960 42 / 0.0002 F-box/RNI-like superfamily protein (.1)
AT3G59250 41 / 0.0002 F-box/RNI-like superfamily protein (.1)
AT5G56440 41 / 0.0004 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT3G59200 41 / 0.0004 F-box/RNI-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G244700
[exp]
89 / 1e-20 AT5G41840 78 / 8e-15 F-box/RNI-like superfamily protein (.1)
Potri.006G248600
[exp]
87 / 7e-20 AT5G41840 82 / 3e-16 F-box/RNI-like superfamily protein (.1)
Potri.017G119200
[exp]
81 / 6e-18 AT3G58900 49 / 8e-06 F-box/RNI-like superfamily protein (.1.2.3.4)
Potri.011G024300
[exp]
50 / 3e-07 AT3G49030 116 / 3e-28 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
Potri.011G104100
[exp]
47 / 3e-06 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.011G104300
[exp]
45 / 2e-05 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1)
Potri.001G322900
[exp]
44 / 3e-05 AT3G18150 166 / 1e-45 RNI-like superfamily protein (.1)
Potri.013G146800
[exp]
41 / 0.0003 AT1G69630 71 / 5e-13 F-box/RNI-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018509
[exp]
49 / 7e-07 AT4G03220 401 / 1e-135 Protein with RNI-like/FBD-like domains (.1)
Lus10020748
[exp]
40 / 0.0005 AT3G28410 73 / 4e-14 F-box/RNI-like superfamily protein (.1)
Lus10002239
[exp]
40 / 0.0006 AT1G69630 91 / 5e-20 F-box/RNI-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Potri.005G252701.1 pacid=42805209 polypeptide=Potri.005G252701.1.p locus=Potri.005G252701 ID=Potri.005G252701.1.v4.1 annot-version=v4.1
ATGGCCTTGCTAGTCAGAGAACGCTGTAGGAAAGCACAATGTAGGAATACCGAGGCGATGGATCAATTCTGGAACTTACCAGATCCCATTATTCATCACA
ATATTTTCTCTTTCCTTGAGATGGATGACATAGCTCGAATTGGTGTGGTATCAAAAAGATTCAGACAGATGTTTGTTTCTAGCCCATATCTGAATGCGGA
TGGGTTGCTGAGCCAGCGAAATGGGATGGCGATACAGCGTCTTTGCCTGGACTGGTATTGCCGCAAGAATAACTGTGATGCAGATGTAAATCTTATTGAC
AAATGGATCAGTGTTGCAGTGAATTGTCGAGTTCAGGAGATTGACCTTGAGTCGGAGGAAAAGCCAATCTGCGAGCTGCCGCAGTGTATGTACAGTTCTG
AAACTTTTAGAGTCCTTGACTTAGATCTGTATTATAAGTGTGTCAAAGAGCCTGCGGGGTTTTTTGTTTCTCTTGAGGAACTCTCCCTGACTCCAGTGGT
AGGTTCTGATTCTGAAGATGTTTTAAAAAAGTTGATTTCAACTGCCTGCCCATCACTTAAAAGGTCGAGTCTTTCCGATTTAAAAGACAGACAAAATTAG
AA sequence
>Potri.005G252701.1 pacid=42805209 polypeptide=Potri.005G252701.1.p locus=Potri.005G252701 ID=Potri.005G252701.1.v4.1 annot-version=v4.1
MALLVRERCRKAQCRNTEAMDQFWNLPDPIIHHNIFSFLEMDDIARIGVVSKRFRQMFVSSPYLNADGLLSQRNGMAIQRLCLDWYCRKNNCDADVNLID
KWISVAVNCRVQEIDLESEEKPICELPQCMYSSETFRVLDLDLYYKCVKEPAGFFVSLEELSLTPVVGSDSEDVLKKLISTACPSLKRSSLSDLKDRQN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G02930 F-box/RNI-like superfamily pro... Potri.005G252701
[exp]
0 1
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.018G133901
[exp]
20.19 0.8738
AT5G07440 GDH2 glutamate dehydrogenase 2 (.1.... Potri.012G113500
[exp]
20.49 0.8712
AT4G34090 unknown protein Potri.001G304401
[exp]
24.24 0.8558
Potri.001G260304
[exp]
28.61 0.8685
Potri.014G007300
[exp]
30.04 0.8862
AT5G50690 ATHSD7 hydroxysteroid dehydrogenase 7... Potri.016G048800
[exp]
40.98 0.8303
AT1G03090 MCCA methylcrotonyl-CoA carboxylase... Potri.005G213300
[exp]
71.35 0.8662 MCCA.1
Potri.012G014550
[exp]
78.96 0.8430
AT3G13540 MYB ATMYB5, ATM2 myb domain protein 5 (.1) Potri.003G079100
[exp]
90.20 0.8608
AT1G11040 HSP40/DnaJ peptide-binding pro... Potri.002G081700
[exp]
98.40 0.8794

Potri.005G252701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.