Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	XCP2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20850 540 / 0 XCP2 xylem cysteine peptidase 2 (.1) AT4G35350 526 / 0 XCP1 xylem cysteine peptidase 1 (.1.2) AT5G43060 374 / 7e-128 Granulin repeat cysteine protease family protein (.1) AT1G47128 372 / 4e-127 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) AT5G50260 366 / 4e-126 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) AT3G48340 356 / 4e-122 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1) AT3G19390 358 / 9e-122 Granulin repeat cysteine protease family protein (.1) AT1G09850 338 / 3e-114 XBCP3 xylem bark cysteine peptidase 3 (.1) AT3G48350 326 / 3e-110 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1) AT4G36880 323 / 5e-109 CP1 cysteine proteinase1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G005700 [exp] 632 / 0 AT1G20850 531 / 0.0 xylem cysteine peptidase 2 (.1) Potri.004G207600 [exp] 545 / 0 AT4G35350 543 / 0.0 xylem cysteine peptidase 1 (.1.2) Potri.014G024100 [exp] 384 / 2e-131 AT5G43060 646 / 0.0 Granulin repeat cysteine protease family protein (.1) Potri.009G098100 [exp] 378 / 3e-129 AT1G47128 607 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Potri.001G302100 [exp] 377 / 1e-128 AT1G47128 598 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Potri.012G090900 [exp] 361 / 4e-124 AT5G50260 561 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Potri.007G047600 [exp] 359 / 3e-123 AT5G43060 461 / 9e-162 Granulin repeat cysteine protease family protein (.1) Potri.005G141600 [exp] 352 / 4e-120 AT4G36880 437 / 1e-153 cysteine proteinase1 (.1) Potri.015G087400 [exp] 351 / 4e-120 AT5G50260 550 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030722 [exp] 541 / 0 AT4G35350 511 / 0.0 xylem cysteine peptidase 1 (.1.2) Lus10013204 [exp] 540 / 0 AT1G20850 509 / 0.0 xylem cysteine peptidase 2 (.1) Lus10024801 [exp] 373 / 3e-127 AT1G47128 633 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Lus10014087 [exp] 372 / 1e-126 AT5G43060 622 / 0.0 Granulin repeat cysteine protease family protein (.1) Lus10033040 [exp] 360 / 9e-124 AT5G50260 555 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10013674 [exp] 360 / 9e-124 AT5G50260 554 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10042078 [exp] 360 / 1e-123 AT5G50260 538 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10018083 [exp] 360 / 2e-123 AT5G50260 533 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10027877 [exp] 360 / 7e-122 AT5G43060 597 / 0.0 Granulin repeat cysteine protease family protein (.1) Lus10002827 [exp] 359 / 1e-121 AT1G47128 609 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF00112 [poplar] [flax] Peptidase_C1 Papain family cysteine protease CL0125 [poplar] [flax] PF08246 [poplar] [flax] Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Representative CDS sequence Show only first row Show all	>Potri.005G256000.2 pacid=42803371 polypeptide=Potri.005G256000.2.p locus=Potri.005G256000 ID=Potri.005G256000.2.v4.1 annot-version=v4.1 ATGGCTCTCCCCGCACTTTCTTTGATTCTTGCGTTGTCTCTCATGTCATTCTTTGCATCTTCTTGTTTAGCTCGTGATTTCTCAATTGTAGGCTATGCCC CAGAAGACTTGACGTCTAGGGATAGGATCATTGATCTCTTTGAATCATGGATATCAAAACACCAGAAGATTTATGAGAGTATTGAAGAAAAATGGCACAG ATTTGAGATTTTCAAAGATAACTTGTTCCACATTGACGAGACCAATAAGAAGGTTGTTAACTACTGGCTTGGATTGAATGAGTTCGCTGATTTGAGCCAC GAAGAGTTCAAAAACAAGTATCTTGGCTTGAATGTTGACTTGTCTAACAGAAGAGAATGCTCTGAGGAATTCACATACAAGGATGTCTCGAGCATCCCCA AGTCAGTGGATTGGAGAAAGAAAGGAGCTGTTACTGATGTCAAGAACCAAGGTTCATGTGGTAGCTGCTGGGCCTTTTCAACAGTGGCAGCAGTAGAAGG TATAAATCAGATTGTTACTGGAAATTTGACATCCCTCTCTGAGCAAGAGTTGGTCGATTGTGATACTACATATAACAATGGATGCAATGGAGGACTTATG GATTATGCATTTGCTTACATAATCTCCAACGGTGGACTCCACAAGGAGGAAGATTACCCATACATCATGGAAGAGGGCACTTGTGAGATGAGAAAGGCAG AATCAGAGGTAGTAACCATTAGTGGATACCATGATGTGCCACAAAACAGTGAAGAAAGCCTATTGAAGGCACTTGCAAACCAGCCCCTCAGTGTGGCCAT TGATGCTTCTGGCAGAGACTTCCAGTTTTACAGCGGGGGTGTTTTTGATGGTCATTGTGGAACCGAGCTAGATCATGGAGTGGCAGCCGTTGGATATGGA TCAGCCAAGGGCTTGGACTTCATCGTAGTTAAAAACTCTTGGGGATCTAAATGGGGAGAAAAGGGTTTCATAAGGATGAAGAGAAACACTGGCAAGCCCG CAGGACTTTGTGGAATCAACAAGATGGCTTCTTATCCCACCAAGAAGAAGTGA
AA sequence Show only first row Show all	>Potri.005G256000.2 pacid=42803371 polypeptide=Potri.005G256000.2.p locus=Potri.005G256000 ID=Potri.005G256000.2.v4.1 annot-version=v4.1 MALPALSLILALSLMSFFASSCLARDFSIVGYAPEDLTSRDRIIDLFESWISKHQKIYESIEEKWHRFEIFKDNLFHIDETNKKVVNYWLGLNEFADLSH EEFKNKYLGLNVDLSNRRECSEEFTYKDVSSIPKSVDWRKKGAVTDVKNQGSCGSCWAFSTVAAVEGINQIVTGNLTSLSEQELVDCDTTYNNGCNGGLM DYAFAYIISNGGLHKEEDYPYIMEEGTCEMRKAESEVVTISGYHDVPQNSEESLLKALANQPLSVAIDASGRDFQFYSGGVFDGHCGTELDHGVAAVGYG SAKGLDFIVVKNSWGSKWGEKGFIRMKRNTGKPAGLCGINKMASYPTKKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G20850		XCP2	xylem cysteine peptidase 2 (.1...		Potri.005G256000 [exp]	0	1	XCP2.1
AT5G61750			RmlC-like cupins superfamily p...		Potri.012G111500 [exp]	1.00	0.9503
AT5G61750			RmlC-like cupins superfamily p...		Potri.015G109600 [exp]	1.41	0.9359
AT5G18460			Protein of Unknown Function (D...		Potri.013G050100 [exp]	3.74	0.8826
AT5G01930		MAN6, AtMAN6	endo-beta-mannase 6, Glycosyl ...		Potri.006G109900 [exp]	3.87	0.9081
AT1G20850		XCP2	xylem cysteine peptidase 2 (.1...		Potri.002G005700 [exp]	4.00	0.8966
AT1G26820		RNS3	ribonuclease 3 (.1)		Potri.008G086800 [exp]	4.47	0.8908	S.4
AT5G40020			Pathogenesis-related thaumatin...		Potri.017G075500 [exp]	6.24	0.8503
AT5G11540			D-arabinono-1,4-lactone oxidas...		Potri.018G039600 [exp]	6.63	0.8210
AT3G49070			Protein of unknown function (D...		Potri.015G147400 [exp]	7.34	0.8736
AT1G10460		GLP7	germin-like protein 7 (.1)		Potri.010G038200 [exp]	7.41	0.8621

Compare expression of checked genes

Potri.005G256000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.