Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76560 115 / 1e-33 CP12-3 CP12 domain-containing protein 3 (.1) AT3G62410 79 / 1e-19 CP12-2 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) AT2G47400 77 / 1e-18 CP12-1 CP12 domain-containing protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G002700 [exp] 173 / 1e-56 AT1G76560 109 / 1e-31 CP12 domain-containing protein 3 (.1) Potri.014G120700 [exp] 89 / 1e-23 AT3G62410 122 / 5e-37 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) Potri.002G196100 [exp] 83 / 4e-21 AT3G62410 89 / 8e-24 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001453 [exp] 80 / 6e-20 AT2G47400 126 / 1e-38 CP12 domain-containing protein 1 (.1) Lus10002428 [exp] 79 / 1e-19 AT2G47400 125 / 4e-38 CP12 domain-containing protein 1 (.1) Lus10025025 [exp] 79 / 2e-19 AT2G47400 125 / 2e-38 CP12 domain-containing protein 1 (.1) Lus10010006 [exp] 40 / 0.0001 AT2G47400 59 / 4e-12 CP12 domain-containing protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02672 [poplar] [flax] CP12 CP12 domain
Representative CDS sequence Show only first row Show all	>Potri.005G258400.1 pacid=42804200 polypeptide=Potri.005G258400.1.p locus=Potri.005G258400 ID=Potri.005G258400.1.v4.1 annot-version=v4.1 ATGGCATCTCTTTCCTTGATCCTGTCTTCATCTAATTTCTCATTAAGATCTGATGCTTTTGGCGACAAATTGTTGAGTATAAGACCTGTTGCTATAAAGA CTACAGGGAGGGACAGTAGTAAGAGGGCTATGAAAGCGATGAGGGTGAAAGCAAGCATGGGAGGTGGTGGAGGAGGCGTGGCAAGGTTCAAAGGGACGCT GGTGAGGAACCAGCTGCTGACAGAGATGATAGAGGAAAAGGTGATAGAAGCGAAGGAAGCATGCAAGGGAGACGCGACATCAGTGGAGTGCAAGGTAGCA TGGGACGAGGTGGAAGAGGTGAGCCAAGCAAAGGCCGATTTCAGGCTCAGGTTGGAGAAGCAGGATCCTCTCGAGTATTATTGTCAAGACAATCCTGAGA CTGACGAGTGTCGAATCTACGAAGATTGA
AA sequence Show only first row Show all	>Potri.005G258400.1 pacid=42804200 polypeptide=Potri.005G258400.1.p locus=Potri.005G258400 ID=Potri.005G258400.1.v4.1 annot-version=v4.1 MASLSLILSSSNFSLRSDAFGDKLLSIRPVAIKTTGRDSSKRAMKAMRVKASMGGGGGGVARFKGTLVRNQLLTEMIEEKVIEAKEACKGDATSVECKVA WDEVEEVSQAKADFRLRLEKQDPLEYYCQDNPETDECRIYED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G76560		CP12-3	CP12 domain-containing protein...		Potri.005G258400 [exp]	0	1
AT5G24690			Protein of unknown function (D...		Potri.001G210500 [exp]	15.00	0.7851
AT5G46030			unknown protein		Potri.011G097300 [exp]	16.43	0.7747
AT3G05700			Drought-responsive family prot...		Potri.013G011200 [exp]	17.77	0.7685
AT3G13062			Polyketide cyclase/dehydrase a...		Potri.014G001100 [exp]	20.97	0.7580
AT5G65760			Serine carboxypeptidase S28 fa...		Potri.007G008100 [exp]	25.49	0.7061
AT1G66750		CDKD1;2, CAK4AT...	CYCLIN-DEPENDENT KINASE D1;2, ...		Potri.016G106725 [exp]	30.29	0.7375
AT3G53700		MEE40	maternal effect embryo arrest ...		Potri.017G033000 [exp]	38.18	0.7659
AT5G56270	WRKY	ATWRKY2, WRKY2,...	ARABIDOPSIS THALIANA WRKY DNA-...		Potri.013G086000 [exp]	69.04	0.7346
AT2G28605			Photosystem II reaction center...		Potri.005G068500 [exp]	82.61	0.7336
AT3G16640		TCTP	translationally controlled tum...		Potri.010G013400 [exp]	95.79	0.7030	Pt-TCTP.2

Compare expression of checked genes

Potri.005G258400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.