Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05030 88 / 3e-24 Copper transport protein family (.1) AT3G20180 61 / 1e-13 Copper transport protein family (.1) AT1G55790 54 / 3e-10 Domain of unknown function (DUF2431) (.1), Domain of unknown function (DUF2431) (.2) AT3G07600 45 / 4e-07 Heavy metal transport/detoxification superfamily protein (.1) AT5G48290 45 / 4e-07 Heavy metal transport/detoxification superfamily protein (.1.2) AT1G01490 38 / 0.0001 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G05920 36 / 0.0005 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G001800 [exp] 105 / 1e-31 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.016G002600 [exp] 91 / 5e-26 AT4G05030 72 / 2e-18 Copper transport protein family (.1) Potri.014G171300 [exp] 73 / 2e-18 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G468500 [exp] 71 / 8e-18 AT4G05030 65 / 1e-14 Copper transport protein family (.1) Potri.006G002000 [exp] 70 / 1e-17 AT4G05030 54 / 3e-11 Copper transport protein family (.1) Potri.001G378700 [exp] 66 / 1e-15 AT3G20180 56 / 5e-11 Copper transport protein family (.1) Potri.014G171500 [exp] 65 / 2e-15 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048100 [exp] 64 / 5e-15 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048400 [exp] 63 / 1e-14 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025181 [exp] 72 / 3e-18 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016062 [exp] 71 / 1e-17 AT5G48290 89 / 2e-23 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039093 [exp] 67 / 2e-16 AT4G05030 72 / 3e-18 Copper transport protein family (.1) Lus10016061 [exp] 66 / 1e-15 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10038769 [exp] 65 / 2e-15 AT4G05030 76 / 3e-19 Copper transport protein family (.1) Lus10025180 [exp] 63 / 1e-14 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025179 [exp] 62 / 1e-13 AT4G05030 62 / 1e-13 Copper transport protein family (.1) Lus10016059 [exp] 61 / 2e-13 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10016063 [exp] 57 / 2e-12 AT3G07600 64 / 8e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016060 [exp] 56 / 1e-11 AT3G07600 64 / 9e-14 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.006G001900.1 pacid=42768643 polypeptide=Potri.006G001900.1.p locus=Potri.006G001900 ID=Potri.006G001900.1.v4.1 annot-version=v4.1 ATGAAGCAAAAGATAGTGCTCGGGGTACAGATGAATTGCCAGAAATGCAGGAGGAAGGCACTCGAGGTTGTGGCAGAAACGGATGGTGTAAGTTTTTTGG GATTAGAAGGAGAGAATAAAGAAAAAGTAGTGGTGATTGGAGATGGAGTTGATGCTGCCAAGTTAGCCTGCAGGTTAAGGAAGAAAGTTGGACATACTGC CATTATCAGTGTTGCACCGACGGATAACTAG
AA sequence Show only first row Show all	>Potri.006G001900.1 pacid=42768643 polypeptide=Potri.006G001900.1.p locus=Potri.006G001900 ID=Potri.006G001900.1.v4.1 annot-version=v4.1 MKQKIVLGVQMNCQKCRRKALEVVAETDGVSFLGLEGENKEKVVVIGDGVDAAKLACRLRKKVGHTAIISVAPTDN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G05030			Copper transport protein famil...		Potri.006G001900 [exp]	0	1
AT5G45540			Protein of unknown function (D...		Potri.001G146800 [exp]	1.41	0.9324
AT5G52060		ATBAG1	BCL-2-associated athanogene 1 ...		Potri.003G121500 [exp]	2.64	0.8863
AT5G07010		ATST2A	ARABIDOPSIS THALIANA SULFOTRAN...		Potri.003G193400 [exp]	4.47	0.9160
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.007G002400 [exp]	9.00	0.9110
AT4G00231		MEE50	maternal effect embryo arrest ...		Potri.008G158901 [exp]	9.79	0.8873
AT5G07010		ATST2A	ARABIDOPSIS THALIANA SULFOTRAN...		Potri.003G193300 [exp]	10.00	0.9104
AT5G09890			Protein kinase family protein ...		Potri.014G028900 [exp]	12.48	0.7418
					Potri.007G026000 [exp]	16.73	0.8453
					Potri.019G108700 [exp]	26.15	0.8240
AT5G13870		EXGT-A4, XTH5, ...	endoxyloglucan transferase A4,...		Potri.001G071000 [exp]	27.98	0.7687	EXGT.1

Compare expression of checked genes

Potri.006G001900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.