Potri.006G005700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47630 107 / 7e-31 MTACP3 mitochondrial acyl carrier protein 3 (.1.2)
AT2G44620 63 / 9e-14 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1)
AT1G65290 61 / 1e-12 MTACP2 mitochondrial acyl carrier protein 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G006300 201 / 5e-68 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2)
Potri.019G055300 64 / 4e-14 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1)
Potri.013G084500 63 / 1e-13 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1)
Potri.014G044000 61 / 5e-13 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1)
Potri.002G135600 50 / 6e-09 AT2G44620 177 / 1e-58 mitochondrial acyl carrier protein 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038782 139 / 2e-43 AT5G47630 112 / 6e-33 mitochondrial acyl carrier protein 3 (.1.2)
Lus10039077 138 / 3e-43 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2)
Lus10000050 138 / 3e-43 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2)
Lus10020221 66 / 1e-14 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1)
Lus10026849 64 / 8e-13 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3)
Lus10019500 61 / 1e-12 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
Lus10043348 61 / 1e-12 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0314 PP-binding PF00550 PP-binding Phosphopantetheine attachment site
Representative CDS sequence
>Potri.006G005700.1 pacid=42770113 polypeptide=Potri.006G005700.1.p locus=Potri.006G005700 ID=Potri.006G005700.1.v4.1 annot-version=v4.1
ATGCAAAGCATAAGAAATTCCATCTTGAGCCACATAAGGCTGAGGGGTTCTGCTGAACAATTTTTATTTGCTCAGAGGGGAAATGTGTTCAAGCAGCTTC
ATCGGCAGATGTGTACATCAGTAGGCACCAGCCCTGATAAAATCATGGATCGAGTCATTGGACTGGTTAAGAAGTTTGATAAAATTGATGCCACTAAGGT
TACTGAGACAGCTGATTTCCAAAAAGATTTGTGCCTGGACAGTTTAGATAGGGTCGAGCTTGTCATGGCTTTTGAGGAAGAATTTTCCATTGAAATCCCT
GAGGAGAAAGCGGATAAACTTACATGTTGCGCTGATGTTGCAAAGTATATAGTTTCAGGAGGTGAGCTGAAAAATGTAAATCCTGAGTAG
AA sequence
>Potri.006G005700.1 pacid=42770113 polypeptide=Potri.006G005700.1.p locus=Potri.006G005700 ID=Potri.006G005700.1.v4.1 annot-version=v4.1
MQSIRNSILSHIRLRGSAEQFLFAQRGNVFKQLHRQMCTSVGTSPDKIMDRVIGLVKKFDKIDATKVTETADFQKDLCLDSLDRVELVMAFEEEFSIEIP
EEKADKLTCCADVAKYIVSGGELKNVNPE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G47630 MTACP3 mitochondrial acyl carrier pro... Potri.006G005700 0 1
AT3G63410 VTE3, APG1, IEP... VITAMIN E DEFECTIVE 3, INNER E... Potri.005G215900 1.00 0.8894
AT5G22330 ATTIP49A, RIN1 RESISTANCE TO PSEUDOMONAS SYRI... Potri.009G160600 2.44 0.8083
AT5G19440 NAD(P)-binding Rossmann-fold s... Potri.009G057500 3.16 0.7905 CCR.8
AT5G48480 Lactoylglutathione lyase / gly... Potri.002G251200 3.31 0.7855
AT1G71260 WHY2, ATWHY2 WHIRLY 2 (.1) Potri.003G048700 3.87 0.8097
AT5G38890 Nucleic acid-binding, OB-fold-... Potri.013G050400 5.19 0.7929
AT3G07910 unknown protein Potri.009G071900 8.94 0.7646
AT1G02280 PPI1, ATTOC33, ... PLASTID PROTEIN IMPORT 1, tran... Potri.002G183400 9.48 0.7672 Pt-PPI1.3
AT4G26410 Uncharacterised conserved prot... Potri.001G001300 11.48 0.7610
AT5G60390 GTP binding Elongation factor ... Potri.010G219500 12.48 0.7766

Potri.006G005700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.