Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50740 142 / 4e-41 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) AT3G02960 125 / 9e-35 Heavy metal transport/detoxification superfamily protein (.1) AT5G63530 119 / 8e-32 ATFP3 ARABIDOPSIS THALIANA FARNESYLATED PROTEIN 3, farnesylated protein 3 (.1.2) AT5G24580 101 / 6e-25 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT2G36950 75 / 3e-15 Heavy metal transport/detoxification superfamily protein (.1) AT5G60800 67 / 8e-13 Heavy metal transport/detoxification superfamily protein (.1.2) AT1G29000 60 / 2e-10 Heavy metal transport/detoxification superfamily protein (.1) AT2G28090 59 / 4e-10 Heavy metal transport/detoxification superfamily protein (.1) AT5G03380 53 / 5e-08 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G66110 50 / 1e-07 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G006600 [exp] 259 / 9e-87 AT5G50740 153 / 5e-45 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Potri.012G101400 [exp] 139 / 4e-39 AT5G63530 204 / 2e-63 ARABIDOPSIS THALIANA FARNESYLATED PROTEIN 3, farnesylated protein 3 (.1.2) Potri.015G099500 [exp] 137 / 2e-38 AT5G50740 214 / 7e-68 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Potri.016G017600 [exp] 116 / 8e-32 AT3G02960 199 / 2e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.012G007300 [exp] 97 / 2e-23 AT5G24580 251 / 5e-82 Heavy metal transport/detoxification superfamily protein (.1.2.3) Potri.015G003900 [exp] 94 / 2e-22 AT5G24580 247 / 1e-80 Heavy metal transport/detoxification superfamily protein (.1.2.3) Potri.006G124800 [exp] 80 / 4e-17 AT2G36950 135 / 2e-36 Heavy metal transport/detoxification superfamily protein (.1) Potri.016G093100 [exp] 74 / 5e-15 AT2G36950 123 / 5e-32 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G214700 [exp] 72 / 1e-14 AT5G60800 142 / 7e-40 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038785 [exp] 199 / 1e-63 AT5G50740 183 / 6e-57 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Lus10039074 [exp] 170 / 6e-52 AT5G50740 182 / 8e-57 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Lus10012867 [exp] 124 / 7e-32 AT2G40770 1843 / 0.0 zinc ion binding;DNA binding;helicases;ATP binding;nucleic acid binding (.1) Lus10032923 [exp] 104 / 5e-26 AT5G24580 313 / 1e-106 Heavy metal transport/detoxification superfamily protein (.1.2.3) Lus10015583 [exp] 101 / 5e-25 AT5G24580 314 / 6e-107 Heavy metal transport/detoxification superfamily protein (.1.2.3) Lus10030514 [exp] 101 / 5e-25 AT5G50740 221 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Lus10037044 [exp] 86 / 4e-20 AT3G02960 137 / 6e-40 Heavy metal transport/detoxification superfamily protein (.1) Lus10015762 [exp] 86 / 5e-20 AT3G02960 151 / 3e-45 Heavy metal transport/detoxification superfamily protein (.1) Lus10014421 [exp] 81 / 3e-17 AT5G03380 193 / 5e-57 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10021516 [exp] 80 / 6e-17 AT5G03380 202 / 2e-61 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.006G006100.1 pacid=42770662 polypeptide=Potri.006G006100.1.p locus=Potri.006G006100 ID=Potri.006G006100.1.v4.1 annot-version=v4.1 ATGGGTGAAGAGAAAAAAGAGGAAGAAAAGAAAGAAGAGGCTAAGGAAGAAGAGAAGAAGGAAGAAAAGAAAGAAGAAGAGCCTCCAGAAATTGTGCTCA AGGTTGATATGCATTGTGAAGCTTGTGCCAGGAAAGTTGCAAGGGCTTTGAAAGGATTTGAAGGAGTGGAGGAAGTAAGCACAGATAGCAAAGCAAGCAA GGTGGTGGTGAAAGGCAAAGCAGCAGACCCATCTAAGGTATGTGAGAGGCTGCAAAAGAAAAGTGGCCGGAAAGTGGAGCTAATTTCACCCTTGCCAAAA CCGCCTGAAGAGAAGAAAGAAGAAGCCAAAGATCCACCCAAGGAAGAAGAGAAAAAAGATGAGCCTCCTCCCGTTGTAACTGTAGTCTTGAACGTTAGAA TGCATTGCGAAGCATGTGCTCAAGTGCTACAAAAGCGAGTTCGAAAGATCCAAGGTGTAGAGTCAGTAGAAACAAACCTAGCCAATGATCAAGTAATAGT AAAAGGGGTGGTTGATCCATCAAAGCTGGTGGATGATGTGTACAAGAAGACTAGAAAACAAGCTTCTATAGTGAAAGATGAAGAAAAGAAGGAAGAAGAG AAGAAAGAAGAGAAAAAGGAAGAAAAAGAAGGAGAAAAGAAAGATGGAGAAGAAGCGAAGGCAGAGGATGACAAGAACCTGGATATCAAGAGAAGTGAAT ATTGGCCATCAAAGTACTACTCTGAGTTTGCTTATGCTCCTCAGATTTTCAGTGATGAAAACCCTAATGCTTGCTCTGTTATGTAA
AA sequence Show only first row Show all	>Potri.006G006100.1 pacid=42770662 polypeptide=Potri.006G006100.1.p locus=Potri.006G006100 ID=Potri.006G006100.1.v4.1 annot-version=v4.1 MGEEKKEEEKKEEAKEEEKKEEKKEEEPPEIVLKVDMHCEACARKVARALKGFEGVEEVSTDSKASKVVVKGKAADPSKVCERLQKKSGRKVELISPLPK PPEEKKEEAKDPPKEEEKKDEPPPVVTVVLNVRMHCEACAQVLQKRVRKIQGVESVETNLANDQVIVKGVVDPSKLVDDVYKKTRKQASIVKDEEKKEEE KKEEKKEEKEGEKKDGEEAKAEDDKNLDIKRSEYWPSKYYSEFAYAPQIFSDENPNACSVM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G50740			Heavy metal transport/detoxifi...		Potri.006G006100 [exp]	0	1
AT1G76980			unknown protein		Potri.005G185200 [exp]	3.87	0.8823
AT5G03110			unknown protein		Potri.006G130500 [exp]	9.74	0.8633
AT2G22860		ATPSK2	phytosulfokine 2 precursor (.1...		Potri.014G006900 [exp]	10.95	0.8621	Pt-PSK3.2
AT2G47840		AtTic20-II	translocon at the inner envelo...		Potri.013G084900 [exp]	12.12	0.8732
AT4G03230			S-locus lectin protein kinase ...		Potri.019G119700 [exp]	15.29	0.8802
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.011G021332 [exp]	18.49	0.8796
AT3G02380	CO	ATCOL2, COL2	CONSTANS-like 2 (.1)		Potri.017G107500 [exp]	20.24	0.8680
AT3G21750		UGT71B1	UDP-glucosyl transferase 71B1 ...		Potri.016G017002 [exp]	20.29	0.8772
AT5G42760			Leucine carboxyl methyltransfe...		Potri.002G260300 [exp]	31.55	0.8744
AT3G02380	CO	ATCOL2, COL2	CONSTANS-like 2 (.1)		Potri.004G108320 [exp]	34.05	0.8392

Compare expression of checked genes

Potri.006G006100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.