Potri.006G006300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39720 48 / 2e-06 VQ motif-containing protein (.1)
AT1G35830 44 / 3e-05 VQ motif-containing protein (.1)
AT5G65170 44 / 5e-05 VQ motif-containing protein (.1)
AT3G22160 41 / 0.0003 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G017900 233 / 7e-77 AT4G15120 / VQ motif-containing protein (.1)
Potri.001G158800 66 / 6e-13 AT4G39720 58 / 6e-10 VQ motif-containing protein (.1)
Potri.003G075800 65 / 2e-12 AT3G22160 54 / 8e-09 VQ motif-containing protein (.1)
Potri.007G091600 47 / 9e-06 AT5G65170 72 / 2e-13 VQ motif-containing protein (.1)
Potri.005G076600 45 / 2e-05 AT5G65170 70 / 7e-13 VQ motif-containing protein (.1)
Potri.005G166100 42 / 0.0004 AT5G65170 94 / 8e-21 VQ motif-containing protein (.1)
Potri.002G094900 41 / 0.0004 AT1G35830 89 / 1e-19 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024738 42 / 0.0004 AT1G35830 92 / 3e-21 VQ motif-containing protein (.1)
Lus10006941 41 / 0.0005 AT1G35830 93 / 3e-21 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.006G006300.1 pacid=42768041 polypeptide=Potri.006G006300.1.p locus=Potri.006G006300 ID=Potri.006G006300.1.v4.1 annot-version=v4.1
ATGAGCGGAATCATGTCCGATAATCCTACCGATTGGTCCCAATTCTACCAACAAAACCTTTCTAACCAAGTCTTACCCCCTATTCGACCCATGTTCCGGG
ATCGAGTCGCCGATTCCACTACTGTCACCACCACCACCATCAATACGTCTGGTGTCCCGAACCCCATGGGTTCGAGCAATTCCAGCTCAAGTGCTGGACG
TCAATTGAGTCCCGAAGGTCGTGTCGCCAAGCCTATTCGTAAGAGGTCTAGGGCTTCAAGAAGAACCCCTACAACATTACTCAATACAGACACCACAAAT
TTCCGAGCCATGGTGCAACAATTCACTGGTGGTCCTAGTGCACCATTTGCATCAGGGTCACAAATTAATGCAACAAATTTTGGTTTTGCATTAGGTGCTT
ATCGTCAAGCTCATCATGTTAATCAACCTAGTCCAGTCATGATGCCACCTGCAGGGTATAATTTGCAATATCAGCAGCAGCAGCAGCAGCAATTCCAGCA
GCAAAGCCAGCATCCATCATCATACATGTTTTCATTGGGCAACAGTAATATCGGTACTAGCACTACCACCACCACCACCACCCCTGGTGATATGTTTTTC
CAGAGACTTGGAAACCCTAGAGTACCTACTACAAGCATGGAAGTTTCTGATCAAGGGTTTGGTTCAACAGAAGGAGCTGTCATTTCTTCCCTGGTGGCTC
CTCCTTCTAGGCCTCCATCTTCCAGCTCCAATGAGAATAGAAGCAATACTTTCTTATTCTGA
AA sequence
>Potri.006G006300.1 pacid=42768041 polypeptide=Potri.006G006300.1.p locus=Potri.006G006300 ID=Potri.006G006300.1.v4.1 annot-version=v4.1
MSGIMSDNPTDWSQFYQQNLSNQVLPPIRPMFRDRVADSTTVTTTTINTSGVPNPMGSSNSSSSAGRQLSPEGRVAKPIRKRSRASRRTPTTLLNTDTTN
FRAMVQQFTGGPSAPFASGSQINATNFGFALGAYRQAHHVNQPSPVMMPPAGYNLQYQQQQQQQFQQQSQHPSSYMFSLGNSNIGTSTTTTTTTPGDMFF
QRLGNPRVPTTSMEVSDQGFGSTEGAVISSLVAPPSRPPSSSSNENRSNTFLF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G39720 VQ motif-containing protein (.... Potri.006G006300 0 1
AT4G32060 calcium-binding EF hand family... Potri.018G118089 7.07 0.9352
AT3G04350 Plant protein of unknown funct... Potri.002G256802 10.19 0.9479
AT5G15720 GLIP7 GDSL-motif lipase 7 (.1) Potri.017G102100 11.74 0.9606
Potri.003G184601 16.97 0.9530
AT1G61680 ATTPS14 terpene synthase 14 (.1.2) Potri.011G032300 19.20 0.9446
AT2G26530 AR781 Protein of unknown function (D... Potri.002G128500 20.00 0.9527
AT3G14440 SIS7, ATNCED3, ... SALT TOLERANT 1, SUGAR INSENSI... Potri.011G112400 20.78 0.9236
AT2G46680 HD ATHB7, ATHB-7 ARABIDOPSIS THALIANA HOMEOBOX ... Potri.001G083700 23.87 0.9056 ATHB.3
AT1G60190 AtPUB19 plant U-box 19, ARM repeat sup... Potri.012G078900 26.21 0.8028
AT2G45360 Protein of unknown function (D... Potri.001G117600 28.63 0.8593

Potri.006G006300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.