Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22120 80 / 4e-18 CWLP cell wall-plasma membrane linker protein (.1) AT3G22142 79 / 2e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G15160 76 / 2e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G62500 70 / 1e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G10940 66 / 4e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G12470 58 / 7e-11 AZI1 azelaic acid induced 1 (.1) AT4G12480 56 / 5e-10 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 54 / 2e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 52 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12530 51 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G008300 [exp] 103 / 9e-28 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G015500 [exp] 94 / 1e-22 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G065500 [exp] 71 / 1e-15 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.018G126000 [exp] 70 / 2e-14 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G111300 [exp] 64 / 1e-12 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 59 / 9e-12 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 51 / 2e-08 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 51 / 2e-08 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G128800 [exp] 50 / 5e-08 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010482 [exp] 84 / 2e-21 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10003801 [exp] 84 / 2e-19 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010479 [exp] 82 / 3e-19 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028930 [exp] 71 / 5e-15 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032262 [exp] 71 / 8e-15 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10027704 [exp] 63 / 2e-12 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10010480 [exp] 62 / 4e-12 ND 127 / 3e-34 Lus10003802 [exp] 62 / 9e-12 ND 127 / 5e-33 Lus10004349 [exp] 59 / 7e-11 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024625 [exp] 57 / 9e-11 AT4G12520 158 / 5e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14547 [poplar] [flax] Hydrophob_seed Hydrophobic seed protein
Representative CDS sequence Show only first row Show all	>Potri.006G008500.1 pacid=42769020 polypeptide=Potri.006G008500.1.p locus=Potri.006G008500 ID=Potri.006G008500.1.v4.1 annot-version=v4.1 ATGGCTAAGTTTGCTGTGGCTAATCTCGTGATCCTTCTTTTGAGCTTGGGCGCTTTGCTTACTTCAATTGCCTGTCCCTCTTGCCCTTCCCCACCTCACC CTAAGCCACCAGTAAAACCTCCCAAAGTAAAGCCGCCACCAATCGTGAAGCCACCAAAGCCTCCAGTAACACCAAAACCACCAGTCGTGAAGCCACCAAA ACCTGAAAAACCATGCCCTCCTCCTCCAGTAATACCAACACCACCAATCGTGAAGCCACCACCAACACCACCGAAGCAAGAGACTTGCCCCATTGACACT CTCAAGTTAGGCGCATGTGTGGATGTCCTAGGTGGACTAATCCACATTGGTATTGGCAGTAGTGCCAAGGATGAATGCTGCCCACTGCTGGAAGGTCTTG TAGACTTGGATGCTGCTGTATGTCTTTGCACCGTTATCAAGGCTAAGCTTCTCAACATCAATCTTATTCTACCCATCGCTCTTGAGCTCCTTGTTGACTG TGGCAAGACCCCACCTGAAGGGTTCAAGTGTCCTTCCTAA
AA sequence Show only first row Show all	>Potri.006G008500.1 pacid=42769020 polypeptide=Potri.006G008500.1.p locus=Potri.006G008500 ID=Potri.006G008500.1.v4.1 annot-version=v4.1 MAKFAVANLVILLLSLGALLTSIACPSCPSPPHPKPPVKPPKVKPPPIVKPPKPPVTPKPPVVKPPKPEKPCPPPPVIPTPPIVKPPPTPPKQETCPIDT LKLGACVDVLGGLIHIGIGSSAKDECCPLLEGLVDLDAAVCLCTVIKAKLLNINLILPIALELLVDCGKTPPEGFKCPS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G22120		CWLP	cell wall-plasma membrane link...		Potri.006G008500 [exp]	0	1
AT1G20440		AtCOR47, RD17, ...	cold-regulated 47 (.1)		Potri.002G013200 [exp]	5.09	0.9185
AT3G49780		ATPSK3(FORMERSY...	phytosulfokine 4 precursor (.1...		Potri.007G006800 [exp]	8.48	0.8926	Pt-PSK3.1
AT4G16490			ARM repeat superfamily protein...		Potri.006G015100 [exp]	10.39	0.8992
AT2G41310		ARR8, ATRR3	RESPONSE REGULATOR 8, response...		Potri.016G038000 [exp]	10.39	0.8638
AT2G45680	TCP	TCP9	TCP family transcription facto...		Potri.002G152200 [exp]	10.39	0.8975
					Potri.018G001950 [exp]	13.60	0.8876
					Potri.016G041301 [exp]	15.49	0.8666
					Potri.016G068650 [exp]	16.24	0.8807
AT1G24330			ARM repeat superfamily protein...		Potri.008G177100 [exp]	16.79	0.8135
AT5G50210		SUFE3, OLD5, QS	SULFUR E 3, ONSET OF LEAF DEAT...		Potri.015G085300 [exp]	24.39	0.8795

Compare expression of checked genes

Potri.006G008500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.