Potri.006G009900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07250 160 / 3e-46 UGT71C4 UDP-glucosyl transferase 71C4 (.1)
AT2G29730 141 / 6e-39 UGT71D1 UDP-glucosyl transferase 71D1 (.1)
AT2G29740 139 / 6e-38 UGT71C2 UDP-glucosyl transferase 71C2 (.1)
AT2G29750 136 / 7e-37 UGT71C1 UDP-glucosyl transferase 71C1 (.1)
AT1G07260 135 / 1e-36 UGT71C3 UDP-glucosyl transferase 71C3 (.1)
AT2G29710 135 / 1e-36 UDP-Glycosyltransferase superfamily protein (.1)
AT1G07240 125 / 8e-33 UGT71C5 UDP-glucosyl transferase 71C5 (.1)
AT3G21780 123 / 3e-32 UGT71B6 UDP-glucosyl transferase 71B6 (.1)
AT3G21760 122 / 7e-32 HYR1 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
AT4G15280 120 / 4e-31 UGT71B5 UDP-glucosyl transferase 71B5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G014500 380 / 3e-131 AT1G07250 394 / 3e-133 UDP-glucosyl transferase 71C4 (.1)
Potri.006G010000 233 / 5e-74 AT1G07250 375 / 3e-126 UDP-glucosyl transferase 71C4 (.1)
Potri.016G015800 223 / 4e-70 AT1G07250 395 / 3e-134 UDP-glucosyl transferase 71C4 (.1)
Potri.016G015700 221 / 2e-69 AT3G21760 354 / 6e-118 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.016G014350 218 / 4e-68 AT3G21760 367 / 7e-123 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.016G014401 212 / 1e-65 AT3G21760 363 / 3e-121 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.016G014300 208 / 3e-64 AT1G07250 363 / 2e-121 UDP-glucosyl transferase 71C4 (.1)
Potri.014G026301 205 / 5e-63 AT1G07250 356 / 2e-118 UDP-glucosyl transferase 71C4 (.1)
Potri.016G014100 197 / 3e-60 AT3G21760 365 / 4e-122 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039037 165 / 1e-47 AT1G07250 378 / 8e-127 UDP-glucosyl transferase 71C4 (.1)
Lus10026795 139 / 5e-38 AT3G21750 448 / 5e-155 UDP-glucosyl transferase 71B1 (.1)
Lus10003805 137 / 4e-37 AT1G07250 332 / 5e-109 UDP-glucosyl transferase 71C4 (.1)
Lus10010476 135 / 1e-36 AT1G07250 342 / 7e-113 UDP-glucosyl transferase 71C4 (.1)
Lus10036086 133 / 1e-35 AT3G21760 431 / 2e-147 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10036087 132 / 1e-35 AT3G21790 455 / 3e-157 UDP-Glycosyltransferase superfamily protein (.1)
Lus10036088 129 / 4e-34 AT3G21760 377 / 3e-126 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10026793 126 / 3e-33 AT3G21780 407 / 4e-138 UDP-glucosyl transferase 71B6 (.1)
Lus10027542 99 / 1e-23 AT3G16520 431 / 3e-148 UDP-glucosyl transferase 88A1 (.1.2.3)
Lus10039301 97 / 8e-23 AT3G16520 481 / 9e-168 UDP-glucosyl transferase 88A1 (.1.2.3)
PFAM info
Representative CDS sequence
>Potri.006G009900.1 pacid=42768828 polypeptide=Potri.006G009900.1.p locus=Potri.006G009900 ID=Potri.006G009900.1.v4.1 annot-version=v4.1
ATGACAGTTTCTCCACCACAATGCTTCTTATGTCCCCACCATTTGCACATAATGCATGCTGCAACATATGCTGAGAAACTTAATGTAACTCATCCTGAGT
TTCAATTCCTAGGTCTTCCTTCTGTGACCCCGCCACCCCTAGAAGATGTTCTAGCTTGTCCTGAACATTTTGTTTCAATTTTCATTGCTGATCATAGAGA
TCATGTTAAGGATGCAATTTTCAACAATGTTTTGTCCAACAAGTCACCTGGTTTGGTTCTTGATTTGTTTTGTACTCCCTTTGTTGATGTTGCAAAAGAC
CTTGGTGTTCCTTCTTATATTTTCTTCGCTTCTGGTGCTGCTTTTCTTGGTTCTATGCTTTACCTTCCTGATAGATTTGACAAGGGAGGGATCACCTTCA
AACCAACTGATCCTGACTCTATCATCCCTGGTTACATCAACCCAGTTCCCTCCAAGGTTTTGCCAAGTTTGTTGTTCCATGATGGAGGGTACTCAACTTT
TGTGGGCCATGCTAGAAAATTCAAGGAGGTAAAGGGTATTATTGTGAATACATTTGCTGAGCTAGAATCCCATCCTGTTAACTATCTTGATGGTGAGGCA
AGTGTACCCCCAGTTAATTTACACTGGGGCCAGTGGTTTGTCACGAGGGCAACAGTGCAGAAGCTGATGGGAACCAACGTGATGACTGATGAGTTCATGA
AGTTTGTTGATGCTCAGCCAGAAAAGTCTCTGGTGTTCTTGTGCTTTGGAAGTCAAGGGAGCTTTAGTGAGCCTCAATTGAAAGAGATTGCACTTTAG
AA sequence
>Potri.006G009900.1 pacid=42768828 polypeptide=Potri.006G009900.1.p locus=Potri.006G009900 ID=Potri.006G009900.1.v4.1 annot-version=v4.1
MTVSPPQCFLCPHHLHIMHAATYAEKLNVTHPEFQFLGLPSVTPPPLEDVLACPEHFVSIFIADHRDHVKDAIFNNVLSNKSPGLVLDLFCTPFVDVAKD
LGVPSYIFFASGAAFLGSMLYLPDRFDKGGITFKPTDPDSIIPGYINPVPSKVLPSLLFHDGGYSTFVGHARKFKEVKGIIVNTFAELESHPVNYLDGEA
SVPPVNLHWGQWFVTRATVQKLMGTNVMTDEFMKFVDAQPEKSLVFLCFGSQGSFSEPQLKEIAL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G07250 UGT71C4 UDP-glucosyl transferase 71C4 ... Potri.006G009900 0 1
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Potri.004G121000 16.06 0.9372
AT1G29450 SAUR-like auxin-responsive pro... Potri.009G141150 21.54 0.9270
AT3G11210 SGNH hydrolase-type esterase s... Potri.016G115800 33.09 0.9269 CPRD49.1
Potri.006G028000 35.24 0.9229
AT3G05470 Actin-binding FH2 (formin homo... Potri.005G026300 40.49 0.9214
AT4G38840 SAUR-like auxin-responsive pro... Potri.009G126900 40.58 0.9211
AT2G45600 alpha/beta-Hydrolases superfam... Potri.014G073000 42.86 0.8764
AT5G27780 SAUR-like auxin-responsive pro... Potri.009G141201 44.18 0.9052
Potri.006G027800 44.35 0.9228
AT5G23940 PEL3, DCR, EMB3... PERMEABLE LEAVES3, EMBRYO DEFE... Potri.015G147300 45.71 0.9205

Potri.006G009900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.