Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16447 46 / 6e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G009200 [exp] 172 / 2e-56 AT4G16447 44 / 2e-06 unknown protein Potri.001G362000 [exp] 74 / 9e-18 AT4G16447 50 / 8e-09 unknown protein Potri.011G086300 [exp] 71 / 1e-16 AT4G16447 40 / 6e-05 unknown protein Potri.014G165000 [exp] 65 / 4e-14 AT4G16447 43 / 5e-06 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043166 [exp] 51 / 6e-09 ND 40 / 6e-05 Lus10032581 [exp] 46 / 5e-07 ND 40 / 7e-05 Lus10012330 [exp] 46 / 1e-06 ND 40 / 2e-04 Lus10006375 [exp] 46 / 1e-06 ND 42 / 4e-05 Lus10004411 [exp] 42 / 2e-05 ND 37 / 9e-04
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G016500.1 pacid=42770536 polypeptide=Potri.006G016500.1.p locus=Potri.006G016500 ID=Potri.006G016500.1.v4.1 annot-version=v4.1 ATGGGCAAGGAAAATACTGATCCTATTGTCATTCAATCCTCTATCGCTTTATTGCAAGAGAGATTTAGGCAATTACAAAGAGTGAAAGCAATGAGGGAGG AAAAGGAGCTATCAAGAAATATACATGTGGAGAGTACCAAGCAGTCAAGTCCCACCATGCAATATCATGAACCAGCAGCAGCCAACAGGCTGTTCTTTCA CCCAGAATTGATCCTTCAACCAAGGTCACCACCCCATGTATGTCTCTCTCTTTGGCCAAACCCACAGAGCAAGCAGGCCGGCTTTCGGTGTGAGGAGACC CCGGCCTTGATGAGTTTATCTTCTACGAAAACTCCTCCTAAGCTTGGTGTACTAGATAAATTTGATGCTTCTGCAACTGATGATGATGATATTGATACTT CTCTTCATTTGTAA
AA sequence Show only first row Show all	>Potri.006G016500.1 pacid=42770536 polypeptide=Potri.006G016500.1.p locus=Potri.006G016500 ID=Potri.006G016500.1.v4.1 annot-version=v4.1 MGKENTDPIVIQSSIALLQERFRQLQRVKAMREEKELSRNIHVESTKQSSPTMQYHEPAAANRLFFHPELILQPRSPPHVCLSLWPNPQSKQAGFRCEET PALMSLSSTKTPPKLGVLDKFDASATDDDDIDTSLHL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G16447			unknown protein		Potri.006G016500 [exp]	0	1
AT1G75710	C2H2ZnF		C2H2-like zinc finger protein ...		Potri.002G023200 [exp]	4.79	0.7507
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Potri.001G015300 [exp]	11.13	0.7296	Pt-LOX2.4
AT4G00730	HD	AHDP, ANL2	ANTHOCYANINLESS 2, ARABIDOPSIS...		Potri.015G141800 [exp]	12.32	0.7477
AT2G40890		REF8, CYP98A3, ...	cytochrome P450, family 98, su...		Potri.016G031100 [exp]	18.41	0.7344
AT5G15410		ATCNGC2, DND1	DEFENSE NO DEATH 1, CYCLIC NUC...		Potri.017G089900 [exp]	28.24	0.6989
AT3G12120		FAD2	fatty acid desaturase 2 (.1.2)		Potri.001G012700 [exp]	31.46	0.7203	Pt-FAD2.1
AT1G11910		ATAPA1, APA1	aspartic proteinase A1 (.1)		Potri.013G002200 [exp]	34.20	0.7279	SOYAP2.2
AT4G37650	GRAS	SGR7, SHR	SHORT ROOT, SHOOT GRAVITROPISM...		Potri.007G063300 [exp]	43.87	0.6714
AT1G17830			Protein of unknown function (D...		Potri.017G155200 [exp]	44.29	0.6932
AT3G19850			Phototropic-responsive NPH3 fa...		Potri.008G085500 [exp]	48.78	0.7138

Compare expression of checked genes

Potri.006G016500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.