Potri.006G016700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26730 91 / 4e-23 Fasciclin-like arabinogalactan family protein (.1)
AT5G16920 78 / 2e-18 Fasciclin-like arabinogalactan family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G009000 103 / 2e-30 AT5G16920 57 / 1e-11 Fasciclin-like arabinogalactan family protein (.1)
Potri.019G049600 86 / 5e-21 AT5G16920 154 / 2e-45 Fasciclin-like arabinogalactan family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006371 103 / 1e-28 AT5G26730 140 / 5e-41 Fasciclin-like arabinogalactan family protein (.1)
Lus10039146 75 / 8e-17 AT5G16920 119 / 1e-31 Fasciclin-like arabinogalactan family protein (.1)
Lus10013786 71 / 3e-15 AT5G16920 125 / 6e-34 Fasciclin-like arabinogalactan family protein (.1)
PFAM info
Representative CDS sequence
>Potri.006G016700.1 pacid=42767666 polypeptide=Potri.006G016700.1.p locus=Potri.006G016700 ID=Potri.006G016700.1.v4.1 annot-version=v4.1
ATGACTGACATTAGGTCACAGAATTTCTTTGGATTGATTTTCTTCCTTCCAATTGATCAAGAATTGACGAGGCACTCGATGTCACCAGACCACCTTGAAG
ACTTCTTGCTCAGCCACTCAATCCCAATGCCACTCACATTCTCTGGCTTGAATCATTTTCCAACAGGGACCATGGTTCCATCAGGGCTTGAGAATCAGCT
GATCGAAATCAAAAACCGTGGGAAAGCAGATTTTTCTGTTAACAATGCCCAAGTTATAAAACCAAACCTTTGCGTAAATTATACAATCAAGTGCCATGGC
ATCGATTCAGTAATCAAGTTTGAAAATGATTACTCAATCAACAATAAACTAGATGAACTTCCATAA
AA sequence
>Potri.006G016700.1 pacid=42767666 polypeptide=Potri.006G016700.1.p locus=Potri.006G016700 ID=Potri.006G016700.1.v4.1 annot-version=v4.1
MTDIRSQNFFGLIFFLPIDQELTRHSMSPDHLEDFLLSHSIPMPLTFSGLNHFPTGTMVPSGLENQLIEIKNRGKADFSVNNAQVIKPNLCVNYTIKCHG
IDSVIKFENDYSINNKLDELP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G26730 Fasciclin-like arabinogalactan... Potri.006G016700 0 1
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Potri.003G150600 33.16 0.5301
AT5G46160 Ribosomal protein L14p/L23e fa... Potri.003G096525 72.82 0.4702

Potri.006G016700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.