Potri.006G016800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G04910 132 / 2e-41 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT1G29380 102 / 3e-27 Carbohydrate-binding X8 domain superfamily protein (.1)
AT3G13560 101 / 3e-26 O-Glycosyl hydrolases family 17 protein (.1.2.3)
AT4G29360 100 / 1e-25 O-Glycosyl hydrolases family 17 protein (.1.2)
AT1G79480 99 / 2e-25 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT3G58100 94 / 2e-25 PDCB5 plasmodesmata callose-binding protein 5 (.1)
AT4G05430 92 / 5e-25 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G67460 95 / 3e-24 O-Glycosyl hydrolases family 17 protein (.1)
AT2G30933 92 / 6e-24 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G164600 172 / 8e-57 AT5G35740 179 / 8e-60 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.001G006500 107 / 2e-28 AT3G13560 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Potri.003G218500 106 / 4e-28 AT3G13560 594 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Potri.002G059600 100 / 1e-26 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.011G078500 99 / 5e-26 AT1G29380 154 / 1e-44 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.001G353400 97 / 4e-25 AT1G29380 144 / 1e-40 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.006G008200 95 / 6e-25 AT1G79480 142 / 8e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.008G082900 97 / 7e-25 AT1G79480 159 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.011G094400 95 / 6e-24 AT5G55180 635 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012324 168 / 3e-55 AT5G35740 164 / 8e-54 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10039059 166 / 6e-54 AT5G35740 157 / 3e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10001167 154 / 2e-49 AT5G35740 150 / 3e-48 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10038801 151 / 1e-48 AT5G35740 146 / 1e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10001740 113 / 5e-34 AT5G35740 111 / 2e-33 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10004600 105 / 3e-28 AT1G29380 168 / 7e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10004546 105 / 3e-28 AT1G29380 175 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10007342 99 / 3e-26 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10020765 99 / 4e-26 AT2G30933 169 / 4e-52 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10002466 96 / 7e-26 AT5G67460 175 / 1e-53 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Potri.006G016800.1 pacid=42767697 polypeptide=Potri.006G016800.1.p locus=Potri.006G016800 ID=Potri.006G016800.1.v4.1 annot-version=v4.1
ATGATGTCACCAAATTTTCCAAGGATTCTTCTCCTAGCTCTGTCCTTCCATGCTTTAATGCTGCAAAAATCAGAGGGTCAATTTGAGGAATGGTGCATAG
CTGATGAGCAAACACCAGATGATGAGTTGCAAAGGGCCATGGACTGGGCATGTGGGAAGGGAGGTGCAGATTGCAGCAAGATTCAAATGAATCAACCTTG
TTATATGCCAAATACAATAAGGGATCATGCCTCTTATGCCTTCAATGATTATTACCAGAAGTTTAAGCATAAAGGAGCAACTTGTTACTTCAACGCTGCT
GCTCTCATCACCGATCTTGATCCAAGTCAGCACTCTTGCAAATTTGATTATCTTCCCTGA
AA sequence
>Potri.006G016800.1 pacid=42767697 polypeptide=Potri.006G016800.1.p locus=Potri.006G016800 ID=Potri.006G016800.1.v4.1 annot-version=v4.1
MMSPNFPRILLLALSFHALMLQKSEGQFEEWCIADEQTPDDELQRAMDWACGKGGADCSKIQMNQPCYMPNTIRDHASYAFNDYYQKFKHKGATCYFNAA
ALITDLDPSQHSCKFDYLP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G35740 Carbohydrate-binding X8 domain... Potri.006G016800 0 1
AT5G41470 Nuclear transport factor 2 (NT... Potri.002G070800 1.00 0.9969
AT4G10810 unknown protein Potri.014G007000 1.73 0.9888
AT1G54860 Glycoprotein membrane precurso... Potri.005G034200 3.46 0.9894
AT1G77700 Pathogenesis-related thaumatin... Potri.001G210400 4.47 0.9888
AT1G63310 unknown protein Potri.001G452900 5.91 0.9886
AT1G63310 unknown protein Potri.011G149100 6.92 0.9850
AT3G17730 NAC ANAC057 NAC domain containing protein ... Potri.015G030200 8.00 0.9821 NAC017
AT2G16050 Cysteine/Histidine-rich C1 dom... Potri.004G209200 8.36 0.9815
Potri.001G393001 8.36 0.9838
Potri.016G136800 8.48 0.9812

Potri.006G016800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.