Potri.006G017100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27330 119 / 2e-37 Ribosome associated membrane protein RAMP4 (.1)
AT1G27350 119 / 2e-37 Ribosome associated membrane protein RAMP4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G171100 117 / 1e-36 AT1G27330 121 / 3e-38 Ribosome associated membrane protein RAMP4 (.1)
Potri.016G008600 115 / 4e-36 AT1G27330 72 / 2e-18 Ribosome associated membrane protein RAMP4 (.1)
Potri.001G057300 114 / 1e-35 AT1G27330 116 / 3e-36 Ribosome associated membrane protein RAMP4 (.1)
Potri.001G057150 95 / 1e-27 AT1G27330 99 / 4e-29 Ribosome associated membrane protein RAMP4 (.1)
Potri.003G171250 72 / 8e-19 AT1G27330 73 / 2e-19 Ribosome associated membrane protein RAMP4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037031 117 / 1e-36 AT1G27350 120 / 6e-38 Ribosome associated membrane protein RAMP4 (.1)
Lus10011355 108 / 5e-33 AT1G27350 108 / 2e-33 Ribosome associated membrane protein RAMP4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06624 RAMP4 Ribosome associated membrane protein RAMP4
Representative CDS sequence
>Potri.006G017100.4 pacid=42767856 polypeptide=Potri.006G017100.4.p locus=Potri.006G017100 ID=Potri.006G017100.4.v4.1 annot-version=v4.1
ATGACAACTTCGAAGCGCCTTTCCGAGAGGAAAGTGGCAAAGTTTCACAAGAATATCACTAAGAGAGGATCTGTTCCTGAAACTTCAACAAAGAAAGGAT
ATGACTACCCAGTTGGGCCAATACTACTTGGATTCTTTGTCTTTGTGGTAATTGGATCATCTCTTTTTCAGATAATCAGGACAGCATCTAGTGGTGGGAT
GGCCTAA
AA sequence
>Potri.006G017100.4 pacid=42767856 polypeptide=Potri.006G017100.4.p locus=Potri.006G017100 ID=Potri.006G017100.4.v4.1 annot-version=v4.1
MTTSKRLSERKVAKFHKNITKRGSVPETSTKKGYDYPVGPILLGFFVFVVIGSSLFQIIRTASSGGMA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G27330 Ribosome associated membrane p... Potri.006G017100 0 1
AT5G39510 ZIG1, SGR4, ATV... SHOOT GRAVITROPSIM 4, VESICLE ... Potri.017G087700 3.46 0.9297
AT3G54120 Reticulon family protein (.1) Potri.016G110200 3.74 0.9406
AT3G12955 SAUR-like auxin-responsive pro... Potri.001G458000 7.48 0.9364 SAUR4
AT1G22520 Domain of unknown function (DU... Potri.019G079101 8.94 0.9118
AT2G33120 ATVAMP722, SAR1 ARABIDOPSIS THALIANA VESICLE-A... Potri.001G050400 10.24 0.9175
AT5G62575 SDH7B, SDH7 succinate dehydrogenase 7B, su... Potri.015G072100 10.81 0.9131
AT5G42330 unknown protein Potri.002G010400 11.40 0.9013
AT3G54880 unknown protein Potri.010G227800 11.95 0.9102
AT3G01390 AVMA10, VMA10 vacuolar membrane ATPase 10 (.... Potri.008G040300 13.03 0.9057 Pt-VMA10.1
AT5G66060 2-oxoglutarate (2OG) and Fe(II... Potri.005G108000 13.85 0.9175

Potri.006G017100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.