Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16400 85 / 8e-22 unknown protein AT3G13175 54 / 1e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G007101 [exp] 127 / 8e-40 AT4G16400 96 / 3e-26 unknown protein Potri.001G366900 [exp] 88 / 4e-24 AT3G13175 75 / 4e-19 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039068 [exp] 85 / 1e-22 AT4G16400 81 / 7e-20 unknown protein Lus10038791 [exp] 84 / 2e-22 AT4G16400 78 / 1e-18 unknown protein Lus10004418 [exp] 74 / 2e-18 AT4G16400 79 / 3e-20 unknown protein Lus10016614 [exp] 72 / 2e-17 AT4G16400 86 / 8e-22 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G017900.1 pacid=42768144 polypeptide=Potri.006G017900.1.p locus=Potri.006G017900 ID=Potri.006G017900.1.v4.1 annot-version=v4.1 ATGGATATCCCAGAAAGGCTTTTGCAATATAGACATCACTTTGCTATAGCAATCACCGCTTCAGTTGTTCTATCTTTATTGTTATATGCTGCTCCTAGGC TAGTCACCATTCTTGCTTACTTCTGGCCTTTATTGGCCTCAACAGCTGTATTCCTGATATTGATCTTAGTCTTTGGAGGTACAGTTACTCACATGGCTAC AGATTCTCATGGTGAAAAAGCAGGCGAAGGGCTTCTTGATTATGTTGCAGGGCAACCAGAAAACGTTGAGCAGTCCCAGAAATACGAGTAA
AA sequence Show only first row Show all	>Potri.006G017900.1 pacid=42768144 polypeptide=Potri.006G017900.1.p locus=Potri.006G017900 ID=Potri.006G017900.1.v4.1 annot-version=v4.1 MDIPERLLQYRHHFAIAITASVVLSLLLYAAPRLVTILAYFWPLLASTAVFLILILVFGGTVTHMATDSHGEKAGEGLLDYVAGQPENVEQSQKYE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G16400			unknown protein		Potri.006G017900 [exp]	0	1
AT1G56700			Peptidase C15, pyroglutamyl pe...		Potri.005G005800 [exp]	1.41	0.8920
AT5G43150			unknown protein		Potri.003G187500 [exp]	2.00	0.8322
AT2G33310	AUX_IAA	IAA13	auxin-induced protein 13 (.1.2...		Potri.008G172400 [exp]	2.82	0.8195	IAA12.1
AT3G63120		CYCP1;1	cyclin p1;1 (.1)		Potri.005G209800 [exp]	3.00	0.8292
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Potri.001G416500 [exp]	4.89	0.7916
AT3G02600		ATLPP3, LPP3	lipid phosphate phosphatase 3 ...		Potri.008G124900 [exp]	5.47	0.8148
AT3G13677			unknown protein		Potri.001G406200 [exp]	6.32	0.7725
AT5G20060			alpha/beta-Hydrolases superfam...		Potri.018G030200 [exp]	10.00	0.7450
AT4G38960	CO		B-box type zinc finger family ...		Potri.004G162600 [exp]	12.24	0.7601
AT5G46295			unknown protein		Potri.011G079900 [exp]	12.96	0.7964

Compare expression of checked genes

Potri.006G017900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.