Potri.006G018200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G022300 51 / 2e-08 AT5G03890 62 / 3e-12 unknown protein
Potri.006G076500 48 / 2e-07 AT2G30230 42 / 7e-05 unknown protein
Potri.016G079700 43 / 9e-06 AT3G10120 114 / 1e-32 unknown protein
Potri.015G005700 40 / 0.0002 AT5G03890 49 / 2e-07 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039070 97 / 2e-26 ND /
Lus10038789 76 / 2e-18 ND /
Lus10008274 42 / 6e-05 AT1G64700 118 / 9e-33 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF14009 DUF4228 Domain of unknown function (DUF4228)
Representative CDS sequence
>Potri.006G018200.1 pacid=42766949 polypeptide=Potri.006G018200.1.p locus=Potri.006G018200 ID=Potri.006G018200.1.v4.1 annot-version=v4.1
ATGGGAAACTGCATTGATGTTCTGTCATATTCATCTGCAGAGAGGAGCAAAGTTCTCATCCATAATGGAGGAGAAAAGGAGTTTAAATCCTCAACGCGGG
TTAAGAAGATCACATCCGGCCGCTACGGTGGTTATATGTTGGTGCATAGTGCGCTACCTTATGTACCATTGCCGCCTGACACCAGGCTGGAACCTGGGGT
AGTTTATTACCTTATGCCTTCCCTTGGTCAACCTTGTAGACTTGAGGTCTCGTCGAAATTGGCCGGACAAGAAACTTGTGCTAGCAGGAAAGTCAAGATT
GTGGTGACTAGGCAGCAGTTGGAGTTGCTGCTGAGAAATTCGAAGCAGTTCAGGTCAAAAGGAATCGCTGTTCGATTCTCTGAAAGTTTTAAGGAAGGAG
AACGAAAGTGGCGGCCATCTTTAGTTACCATTCCAGAAGTGCAGAAGTTTTAA
AA sequence
>Potri.006G018200.1 pacid=42766949 polypeptide=Potri.006G018200.1.p locus=Potri.006G018200 ID=Potri.006G018200.1.v4.1 annot-version=v4.1
MGNCIDVLSYSSAERSKVLIHNGGEKEFKSSTRVKKITSGRYGGYMLVHSALPYVPLPPDTRLEPGVVYYLMPSLGQPCRLEVSSKLAGQETCASRKVKI
VVTRQQLELLLRNSKQFRSKGIAVRFSESFKEGERKWRPSLVTIPEVQKF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G018200 0 1
AT1G67980 CCOAMT caffeoyl-CoA 3-O-methyltransfe... Potri.010G104400 78.76 0.4207 CAML3

Potri.006G018200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.