Potri.006G018400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16380 82 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
AT1G49420 70 / 5e-15 Heavy metal transport/detoxification superfamily protein (.1)
AT1G51090 64 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G018901 276 / 8e-96 AT4G16380 81 / 1e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019800 225 / 1e-75 AT4G16380 82 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020100 220 / 4e-74 AT4G16380 76 / 7e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019700 219 / 9e-74 AT4G16380 76 / 4e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020500 216 / 2e-72 AT4G16380 73 / 9e-16 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019400 214 / 1e-71 AT4G16380 79 / 4e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019500 202 / 9e-67 AT4G16380 78 / 7e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020000 164 / 2e-52 AT4G16380 68 / 2e-14 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019600 149 / 5e-46 AT4G16380 69 / 3e-14 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039073 104 / 3e-28 AT4G16380 103 / 2e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10038786 104 / 6e-28 AT1G49420 108 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1)
Lus10001913 64 / 4e-12 AT4G16380 90 / 1e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10000039 62 / 5e-12 AT4G16380 81 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.006G018400.1 pacid=42768511 polypeptide=Potri.006G018400.1.p locus=Potri.006G018400 ID=Potri.006G018400.1.v4.1 annot-version=v4.1
ATGGTGGAAACGAAAGTCACAACGATGGTGATCAAGGTGGTTGACCTTGGATGCGAAAAATGCCACAAGAAAATCAAGAAAGTACTGTGTGGTATCCCTC
AAATCCAGAACCAGATATATGACAAGAAGGAAAACACAGTGACAATCACTGTGGTGTGTTGCAGTCCTGAAAAGATCAAGAAAAAAATATACTGCAAAGG
AGGTGAAGCTGTCAAGTGCATTGAGATCAAGCTGCCTCCACCTCCACCTCCACCTTCACCACCACCTCCACCTCCACCTCCACCTCCACCTCCACCTTCA
CCACCACCATCACCACCTCCATCACCACCTCCATCACCACCTCCACCACCATGCACATGCACATGTTGTGAAAAATGCCGCCGAGGCCCATGTTGTCATC
ACTTTTGTATGCCAATAGTACCTCCATATTTTCATGTACCTTGTAGATGGTCAGAGTGTGATCTATGGGGAGATGGTTGTTGTAGTTGCCGAAGTAGGGG
TTACTATGTGTGCAGAAGTGCATATGTTTATGAAGAGTACTACTATCCCCCGACATGCAAATGA
AA sequence
>Potri.006G018400.1 pacid=42768511 polypeptide=Potri.006G018400.1.p locus=Potri.006G018400 ID=Potri.006G018400.1.v4.1 annot-version=v4.1
MVETKVTTMVIKVVDLGCEKCHKKIKKVLCGIPQIQNQIYDKKENTVTITVVCCSPEKIKKKIYCKGGEAVKCIEIKLPPPPPPPSPPPPPPPPPPPPPS
PPPSPPPSPPPSPPPPPCTCTCCEKCRRGPCCHHFCMPIVPPYFHVPCRWSECDLWGDGCCSCRSRGYYVCRSAYVYEEYYYPPTCK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16380 Heavy metal transport/detoxifi... Potri.006G018400 0 1
Potri.001G387000 2.44 0.8581
AT1G53163 unknown protein Potri.011G116600 3.16 0.9006
AT3G18670 Ankyrin repeat family protein ... Potri.004G003600 5.83 0.8779
AT2G26600 Glycosyl hydrolase superfamily... Potri.006G067500 12.64 0.7972
AT3G14310 ATPME3 pectin methylesterase 3 (.1) Potri.001G162500 14.07 0.8023 PME2.16
Potri.016G011250 14.69 0.8004
AT5G45540 Protein of unknown function (D... Potri.006G010900 17.02 0.8308
AT3G12410 Polynucleotidyl transferase, r... Potri.006G031400 18.97 0.7379
AT1G76160 SKS5 SKU5 similar 5 (.1) Potri.002G227600 23.23 0.8292
AT5G62940 DOF AtDof5.6, HCA2 HIGH CAMBIAL ACTIVITY2, DNA BI... Potri.015G077100 23.32 0.8214

Potri.006G018400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.