Potri.006G018766 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16380 53 / 8e-09 Heavy metal transport/detoxification superfamily protein (.1.2)
AT1G49420 39 / 0.0005 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G018901 105 / 3e-29 AT4G16380 81 / 1e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018400 101 / 2e-27 AT4G16380 81 / 9e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019700 97 / 8e-26 AT4G16380 76 / 4e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020500 97 / 9e-26 AT4G16380 73 / 9e-16 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019800 95 / 9e-25 AT4G16380 82 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020100 94 / 2e-24 AT4G16380 76 / 7e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019400 89 / 2e-22 AT4G16380 79 / 4e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019600 81 / 2e-19 AT4G16380 69 / 3e-14 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020300 72 / 7e-16 AT4G16380 70 / 1e-14 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039073 58 / 8e-11 AT4G16380 103 / 2e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10038786 59 / 1e-10 AT1G49420 108 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1)
Lus10001913 56 / 1e-09 AT4G16380 90 / 1e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10000039 51 / 2e-08 AT4G16380 81 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.006G018766.1 pacid=42770256 polypeptide=Potri.006G018766.1.p locus=Potri.006G018766 ID=Potri.006G018766.1.v4.1 annot-version=v4.1
ATGCAAAAAATGCCACAAGAAAATCAAGAAAGTTCTGTGTGGTATCTCTCAGAAATCCAGAACCAGATATATGACAAGAAGGAAAACACAGTGACAATCA
CTTTGGTGGGTTGCTGTCCTGAAAAGATCAAGACAAAAATATACTGCAAAGGAGGTGAAGCTGTCAAGTGCATTGAGATCAAGCCGCCTCCACCTTCACC
ACCACCTTCACCACCACCTCCACCTTCACCACCACCTTCACCACCACCTCCACCACCATCACCACCACCATCACCACCTCCACCACCATGCACATGCACA
TGCTGTGAAAAATGCCGCCGAGGCCCATGTTGTCATCACTTTTGTATGCCAACAAGTGTGATATATGGGGAGATGGTTGTTGTAGTTGCCGAAGTAGGGG
TTACTATGTGTGCAGAAAATCATGTAAAGGGAAATCAAGTTCAGAAGACCGATGGTTTGAGTCAACGTCCAAGATCAAACATTGGATTCAAATCCAGTGG
TCATGATGGACCTTAG
AA sequence
>Potri.006G018766.1 pacid=42770256 polypeptide=Potri.006G018766.1.p locus=Potri.006G018766 ID=Potri.006G018766.1.v4.1 annot-version=v4.1
MQKMPQENQESSVWYLSEIQNQIYDKKENTVTITLVGCCPEKIKTKIYCKGGEAVKCIEIKPPPPSPPPSPPPPPSPPPSPPPPPPSPPPSPPPPPCTCT
CCEKCRRGPCCHHFCMPTSVIYGEMVVVVAEVGVTMCAENHVKGNQVQKTDGLSQRPRSNIGFKSSGHDGP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16380 Heavy metal transport/detoxifi... Potri.006G018766 0 1
AT2G48010 RKF3 receptor-like kinase in in flo... Potri.013G028000 4.89 0.7897
AT3G20300 Protein of unknown function (D... Potri.001G356200 9.32 0.7738
AT4G16380 Heavy metal transport/detoxifi... Potri.006G019100 10.58 0.7738
AT1G04710 KAT1, PKT4 3-KETO-ACYL-COA THIOLASE 1, pe... Potri.013G097500 11.04 0.8227 PED1.2
AT4G10270 Wound-responsive family protei... Potri.013G147900 17.20 0.7988
AT5G08350 GRAM domain-containing protein... Potri.005G088700 23.81 0.7887
AT1G64160 Disease resistance-responsive ... Potri.001G096680 33.58 0.7756
AT3G05950 RmlC-like cupins superfamily p... Potri.011G163200 36.66 0.7836 Pt-GER2.29
AT1G64160 Disease resistance-responsive ... Potri.013G142602 40.39 0.7732
AT1G64160 Disease resistance-responsive ... Potri.001G096800 42.70 0.7709 Pt-DRR206.2

Potri.006G018766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.