Potri.006G019200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16380 86 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
AT1G51090 67 / 7e-14 Heavy metal transport/detoxification superfamily protein (.1)
AT1G49420 65 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1)
AT5G27690 40 / 0.001 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G019300 137 / 1e-39 AT4G16380 94 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019800 110 / 2e-30 AT4G16380 82 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018400 110 / 3e-30 AT4G16380 81 / 9e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018901 109 / 5e-30 AT4G16380 81 / 1e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019100 111 / 2e-29 AT4G16380 59 / 8e-10 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018500 103 / 1e-27 AT4G16380 77 / 4e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019500 102 / 2e-27 AT4G16380 78 / 7e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019400 102 / 3e-27 AT4G16380 79 / 4e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020500 97 / 6e-25 AT4G16380 73 / 9e-16 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039073 106 / 6e-29 AT4G16380 103 / 2e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10038786 106 / 2e-28 AT1G49420 108 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1)
Lus10001913 57 / 7e-10 AT4G16380 90 / 1e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10000039 56 / 1e-09 AT4G16380 81 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Potri.006G019200.1 pacid=42769766 polypeptide=Potri.006G019200.1.p locus=Potri.006G019200 ID=Potri.006G019200.1.v4.1 annot-version=v4.1
ATGGCTGAAAAGAAAGTCACAACAATGGTGATGAAGGTTGACCTTGAATGTGAGAAATGCCACAAGAAAATCAAGAAAGTACTGTGTAGAATCCCTCAAA
TTCAGAACCAGATATATGACAAGAAGGCAGGCACAGTGACCATCACTGTGGTATGTTGCAGTCCTGAAAAGATCAAGGAAAAGATAGTCTGTAAAGGAGG
TGAAGCTGTCAAGAGCATTGAGATCAAGGTTCCAGAGAAACCCAAAGAACCACCAGCTAAACCTAAAGAACCGGAGAAACCCAAAGAACCGGAGAAACCC
AAAGCACCAAGCAAACAACCGGACAAGCCTCCACCAACAGTTGATAGCGATAGCAAGCTCAAAGGACCAGACAAGCCGAAAGCGCTTATTGTTGAACCAG
TCCACCCAATGACATGTTGTGCTGAATGCTACCGAGGGATTAGTGGAGGCCCATGTTATCATGACTATGGTAGGCCGGCACCCCCAAGTTATGAAATTTA
TGGAAGGCCAGTGCATGATAGTTGGGGTGGCAGCGGCGGCTGTGGTTGCCAAAGAAGCGGTTACTATGCGTGCCGATGTGAATATGTTTGTGAAGATAAT
CCCTCGTCATGCACAATCATGTGA
AA sequence
>Potri.006G019200.1 pacid=42769766 polypeptide=Potri.006G019200.1.p locus=Potri.006G019200 ID=Potri.006G019200.1.v4.1 annot-version=v4.1
MAEKKVTTMVMKVDLECEKCHKKIKKVLCRIPQIQNQIYDKKAGTVTITVVCCSPEKIKEKIVCKGGEAVKSIEIKVPEKPKEPPAKPKEPEKPKEPEKP
KAPSKQPDKPPPTVDSDSKLKGPDKPKALIVEPVHPMTCCAECYRGISGGPCYHDYGRPAPPSYEIYGRPVHDSWGGSGGCGCQRSGYYACRCEYVCEDN
PSSCTIM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16380 Heavy metal transport/detoxifi... Potri.006G019200 0 1
AT3G02875 ILR1 IAA-LEUCINE RESISTANT 1, Pepti... Potri.006G207300 7.74 0.7950 ILR1.1
AT1G27340 Galactose oxidase/kelch repeat... Potri.003G062000 9.53 0.7567
AT5G41315 bHLH MYC6.2, GL3 GLABROUS 3, GLABRA 3, basic he... Potri.002G159400 11.57 0.7878 Pt-TAN1.2
AT5G17760 P-loop containing nucleoside t... Potri.007G020800 12.48 0.7572
AT3G02875 ILR1 IAA-LEUCINE RESISTANT 1, Pepti... Potri.006G207400 14.00 0.6924 ILL1,Pt-ILR1.2
Potri.014G049000 17.83 0.7746
AT3G45070 P-loop containing nucleoside t... Potri.010G138400 21.67 0.7629
AT3G07320 O-Glycosyl hydrolases family 1... Potri.002G247800 22.62 0.7531 SGGN1.1
AT5G53970 TAT7 tyrosine aminotransferase 7, T... Potri.017G014000 24.00 0.7663
AT4G13990 Exostosin family protein (.1) Potri.001G321000 24.49 0.7368

Potri.006G019200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.