Potri.006G020500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16380 73 / 8e-16 Heavy metal transport/detoxification superfamily protein (.1.2)
AT1G49420 62 / 5e-12 Heavy metal transport/detoxification superfamily protein (.1)
AT1G51090 56 / 4e-10 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G020100 252 / 1e-86 AT4G16380 76 / 7e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019800 240 / 1e-81 AT4G16380 82 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019400 238 / 7e-81 AT4G16380 79 / 4e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019500 225 / 8e-76 AT4G16380 78 / 7e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019700 224 / 1e-75 AT4G16380 76 / 4e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018901 206 / 2e-68 AT4G16380 81 / 1e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018400 204 / 2e-67 AT4G16380 81 / 9e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019600 189 / 6e-62 AT4G16380 69 / 3e-14 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020000 182 / 2e-59 AT4G16380 68 / 2e-14 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039073 92 / 1e-23 AT4G16380 103 / 2e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10038786 93 / 2e-23 AT1G49420 108 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1)
Lus10001913 52 / 3e-08 AT4G16380 90 / 1e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10000039 50 / 6e-08 AT4G16380 81 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Potri.006G020500.1 pacid=42769944 polypeptide=Potri.006G020500.1.p locus=Potri.006G020500 ID=Potri.006G020500.1.v4.1 annot-version=v4.1
ATGGTAGAAACGAAAGTCACAGAGATGGTGATTAAGGTGGTTGACCTTGGCTGCGAAAAATGCCACAAGAAAATCAAGAGAGTACTGTGTGCTATCCCTC
AAATCCAGAACCAGACATATGACAAGAAGGAAAACACAGTGACAATCACTGTGGTGGGTTGCTGTCCTGAAAAGATCAAGAAAAAAATATACTGCAAAGG
AGGTCGAACTGTCAAGTGCGTTGAGATCAAGCCGCCTCCGAAGGAAAAACAAGAAAAAAAACCAGAAAAAAAAAAACCAGAAGCAAAACCAGAAGAAAAA
CCAGAACCAAAACCAAAACTAGAAAAAGAACCAGAACCGAAACCAAAACCATGCACATGTTGTGAAAAATGCCGCCGAGGCCCATGTTGTCATCACTTTT
GTATGCCAACACCTCCTGCATATTGTCCTGTACCTTGTAGAAGGTCAGAGTGTGATATATGGGGAGATGGTTGTTGTAGTTGCCGAAGTAGGGGTTACTA
TGTGTGCAGAAGTGCATATGTTTATGAAGACTATTATCCCTCGGCGCCATGCACAATCATGTAA
AA sequence
>Potri.006G020500.1 pacid=42769944 polypeptide=Potri.006G020500.1.p locus=Potri.006G020500 ID=Potri.006G020500.1.v4.1 annot-version=v4.1
MVETKVTEMVIKVVDLGCEKCHKKIKRVLCAIPQIQNQTYDKKENTVTITVVGCCPEKIKKKIYCKGGRTVKCVEIKPPPKEKQEKKPEKKKPEAKPEEK
PEPKPKLEKEPEPKPKPCTCCEKCRRGPCCHHFCMPTPPAYCPVPCRRSECDIWGDGCCSCRSRGYYVCRSAYVYEDYYPSAPCTIM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16380 Heavy metal transport/detoxifi... Potri.006G020500 0 1
AT4G16380 Heavy metal transport/detoxifi... Potri.006G019800 6.48 0.8908
AT5G21990 OEP61, TPR7 tetratricopeptide repeat 7, ou... Potri.005G156250 6.92 0.8803
AT4G16380 Heavy metal transport/detoxifi... Potri.006G020300 7.54 0.8714
AT1G74180 AtRLP14 receptor like protein 14 (.1) Potri.001G064600 8.00 0.9043
Potri.004G179822 8.06 0.8838
AT4G27360 Dynein light chain type 1 fami... Potri.004G034000 11.48 0.8615
AT5G19820 EMB2734 embryo defective 2734, ARM rep... Potri.017G137400 11.66 0.8346
AT3G61700 Plant protein 1589 of unknown ... Potri.012G001900 12.32 0.8213
AT4G09660 unknown protein Potri.014G176225 16.97 0.8944
AT2G29940 ABCG31, PDR3, A... ATP-binding cassette G31, plei... Potri.009G045601 18.16 0.8873

Potri.006G020500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.