Plant FIBer expression Database

Potri.006G021600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G019201
[exp]
58 / 7e-13 AT1G05340 / unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039015
[exp]
35 / 0.0006 AT2G32190 76 / 3e-20 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF12734 CYSTM Cysteine-rich TM module stress tolerance
Representative CDS sequence
>Potri.006G021600.1 pacid=42768193 polypeptide=Potri.006G021600.1.p locus=Potri.006G021600 ID=Potri.006G021600.1.v4.1 annot-version=v4.1
ATGAGTCAGAATCAAGCTACAGTGGCATATCCTCCCCCACCAACATCAACTTATCCTAGTGCATATTCAGGCCCACCACCAGCTGGCTATCCAACCATGG
ATGGTCAATCCGACCAGCAAAATCCTATTCCTGTGAAGACTAAATCCAGGGGTGATGGCTTCTGGAAGGGATGTTGTGCTGCCTTGTGTTGCTGTTGTCT
CTGCGACGCTTGCTTTTGA
AA sequence
>Potri.006G021600.1 pacid=42768193 polypeptide=Potri.006G021600.1.p locus=Potri.006G021600 ID=Potri.006G021600.1.v4.1 annot-version=v4.1
MSQNQATVAYPPPPTSTYPSAYSGPPPAGYPTMDGQSDQQNPIPVKTKSRGDGFWKGCCAALCCCCLCDACF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G05340 unknown protein Potri.006G021600
[exp]
0 1
AT3G55430 O-Glycosyl hydrolases family 1... Potri.008G055900
[exp]
1.00 0.9157
AT4G37640 ACA2 calcium ATPase 2 (.1) Potri.007G055500
[exp]
8.94 0.9040 Pt-ACA2.1
AT5G47910 ATRBOHD, RBOHD respiratory burst oxidase homo... Potri.003G159800
[exp]
9.94 0.9006
AT4G30780 unknown protein Potri.006G180500
[exp]
12.72 0.8221
AT2G24300 Calmodulin-binding protein (.1... Potri.006G187900
[exp]
13.96 0.8647 CBP60.9
AT5G64300 ATGCH, ATRIBA1,... RED FLUORESCENT IN DARKNESS 1,... Potri.001G310500
[exp]
14.24 0.8443
AT4G39830 Cupredoxin superfamily protein... Potri.007G088358
[exp]
16.00 0.8893
AT4G27220 NB-ARC domain-containing disea... Potri.019G014334
[exp]
17.14 0.8499
AT5G49620 MYB ATMYB78 myb domain protein 78 (.1.2) Potri.002G191800
[exp]
18.02 0.8816
AT2G33060 AtRLP27 receptor like protein 27 (.1) Potri.012G025300
[exp]
18.89 0.8782

Potri.006G021600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.