Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3) AT3G02070 284 / 7e-98 Cysteine proteinases superfamily protein (.1) AT5G04250 236 / 2e-77 Cysteine proteinases superfamily protein (.1.2) AT5G03330 220 / 6e-71 Cysteine proteinases superfamily protein (.1.2) AT2G39320 88 / 2e-21 Cysteine proteinases superfamily protein (.1) AT5G67170 72 / 1e-14 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2) AT2G27350 54 / 2e-08 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G019700 [exp] 389 / 5e-139 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3) Potri.014G140200 [exp] 285 / 6e-98 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1) Potri.006G125900 [exp] 235 / 8e-77 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2) Potri.016G094700 [exp] 234 / 8e-77 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2) Potri.010G225400 [exp] 220 / 8e-71 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2) Potri.008G036700 [exp] 217 / 2e-69 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2) Potri.008G036900 [exp] 195 / 3e-63 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2) Potri.005G140500 [exp] 72 / 1e-14 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2) Potri.004G196800 [exp] 59 / 3e-10 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010459 [exp] 360 / 1e-127 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3) Lus10027312 [exp] 332 / 9e-116 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3) Lus10003816 [exp] 323 / 2e-113 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3) Lus10038708 [exp] 227 / 2e-73 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2) Lus10026525 [exp] 223 / 3e-72 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2) Lus10037977 [exp] 221 / 3e-71 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2) Lus10001404 [exp] 216 / 3e-69 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2) Lus10023019 [exp] 213 / 4e-68 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2) Lus10013813 [exp] 212 / 1e-67 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2) Lus10037388 [exp] 199 / 4e-63 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF02338 [poplar] [flax] OTU OTU-like cysteine protease
Representative CDS sequence Show only first row Show all	>Potri.006G021700.10 pacid=42770585 polypeptide=Potri.006G021700.10.p locus=Potri.006G021700 ID=Potri.006G021700.10.v4.1 annot-version=v4.1 ATGACTGAAAGCAATAGCAATGCAAGTGTGAGCTCGAGTTCGAGTTTGAATAGCAGCTTTCCGGACATAGAGGATGACCAAACCATTGCAAGCATCTTAG CAGAAGATGAAAGTTCTCAAGTTGCTGGAACGCTTGGGAAGAGACTGTCGCATTTGGACTCCATACCACACACTCCACGGGTGAATGGTGAGATACCTGA TGTGAATGATGCAACCTTAGACCATGAGCGACTGTCTGAAAGGTTGGCAACATATGGTTTAGAAGAACTGCAAATCGAGGGCGATGGGAATTGTCAGTTT CGAGCATTAGCAGACCAATTGTTCCGCAGTCCAGATTACCACAAACATGTGAGGAAGAAAATAGTCAAGCAGCTAAAGCATTTCAGAAAATCATATGAGG GATATGTCCCCATGAAGTACAGAAGCTATGTGAAGAAGATGAAAAAGCCAGGGGAGTGGGGGGATCATCTAACTCTACAGGCAGCGGCAGATCGATTTGG TGCCAAAATTTGTTTGGTAACATCTTTCCGGGACACATGCTATATCGAGATCATGCCCAAAGACAAAAGTCCCACCAGAGAACTTTGGCTGAGCTTTTGG AGCGAAGTTCATTACAATTCATTGTATGCAACTGGAGATGTCCCGACCAGAGTAGCAAGAAAGAAGCATTGGCTTTTTTAA
AA sequence Show only first row Show all	>Potri.006G021700.10 pacid=42770585 polypeptide=Potri.006G021700.10.p locus=Potri.006G021700 ID=Potri.006G021700.10.v4.1 annot-version=v4.1 MTESNSNASVSSSSSLNSSFPDIEDDQTIASILAEDESSQVAGTLGKRLSHLDSIPHTPRVNGEIPDVNDATLDHERLSERLATYGLEELQIEGDGNCQF RALADQLFRSPDYHKHVRKKIVKQLKHFRKSYEGYVPMKYRSYVKKMKKPGEWGDHLTLQAAADRFGAKICLVTSFRDTCYIEIMPKDKSPTRELWLSFW SEVHYNSLYATGDVPTRVARKKHWLF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G22260			Cysteine proteinases superfami...		Potri.006G021700 [exp]	0	1
AT1G75180			Erythronate-4-phosphate dehydr...		Potri.009G115800 [exp]	9.32	0.6703
AT1G32340		NHL8	NDR1/HIN1-like 8 (.1)		Potri.001G139400 [exp]	14.38	0.6987	NHL8.1
AT1G32170		XTH30, XTR4	xyloglucan endotransglycosylas...		Potri.003G097300 [exp]	15.96	0.6861	Pt-XTR4.1
AT1G16840			unknown protein		Potri.010G252800 [exp]	18.65	0.7085
AT1G07870			Protein kinase superfamily pro...		Potri.009G026500 [exp]	19.07	0.6881
AT5G41350			RING/U-box superfamily protein...		Potri.001G101700 [exp]	19.74	0.6736
AT1G64140			unknown protein		Potri.003G134200 [exp]	28.98	0.7068
AT5G48820		ICK6, KRP3	KIP-RELATED PROTEIN 3, inhibit...		Potri.001G314000 [exp]	29.79	0.7049
AT3G06330			RING/U-box superfamily protein...		Potri.010G014950 [exp]	33.22	0.6577
AT3G06330			RING/U-box superfamily protein...		Potri.010G014800 [exp]	33.76	0.6626

Compare expression of checked genes

Potri.006G021700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.