Potri.006G024500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20950 68 / 4e-14 Phosphofructokinase family protein (.1)
AT1G76550 64 / 6e-13 Phosphofructokinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G257800 71 / 3e-15 AT1G76550 1065 / 0.0 Phosphofructokinase family protein (.1)
Potri.002G003100 61 / 7e-12 AT1G76550 1034 / 0.0 Phosphofructokinase family protein (.1)
Potri.016G023380 43 / 1e-06 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016047 74 / 4e-16 AT1G20950 1075 / 0.0 Phosphofructokinase family protein (.1)
Lus10025167 72 / 1e-15 AT1G20950 1075 / 0.0 Phosphofructokinase family protein (.1)
Lus10031302 60 / 1e-12 ND 40 / 5e-05
PFAM info
Representative CDS sequence
>Potri.006G024500.1 pacid=42768127 polypeptide=Potri.006G024500.1.p locus=Potri.006G024500 ID=Potri.006G024500.1.v4.1 annot-version=v4.1
ATGGATTCCTTGTCTTCTTCGCTTGAAGGCTGTGGCTCAACTGAAACACTGGTGGAAGACAAGGAACTCAACTTTGCTCAACTAGAGGAGATAGACATGA
AAACTGAAGCAGTTGCTGGAAGATCAGTTGACAATGTCCATGGGAAAACTGGTGCTGTTCAACTGGATAGAGTGGGATCAGACAAGAAGGCTTGCGGCCA
TGGTACTTTAACAGAAGACCAAGAATATATCAAGGAAATAAAGGAGTTGCATGCATACCTTGACATAGTGAAAACAATGGTGAGACCAGGTTGCTCCCCT
GAAGTGCTGAAAATTGCTTTGAATTCCATGTCAACACTTTTCAACACCCTTACCTTTGTGTCTTCCGTGACAAGACCCCATGCATCCCTTTGA
AA sequence
>Potri.006G024500.1 pacid=42768127 polypeptide=Potri.006G024500.1.p locus=Potri.006G024500 ID=Potri.006G024500.1.v4.1 annot-version=v4.1
MDSLSSSLEGCGSTETLVEDKELNFAQLEEIDMKTEAVAGRSVDNVHGKTGAVQLDRVGSDKKACGHGTLTEDQEYIKEIKELHAYLDIVKTMVRPGCSP
EVLKIALNSMSTLFNTLTFVSSVTRPHASL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G20950 Phosphofructokinase family pro... Potri.006G024500 0 1
AT1G05970 RNA-binding (RRM/RBD/RNP motif... Potri.017G030000 1.00 0.8886
AT2G35320 ATEYA EYES ABSENT homolog (.1) Potri.001G144000 2.44 0.8773
AT4G22220 ATISU1, ISU1 SufE/NifU family protein (.1) Potri.015G077500 4.47 0.8708
AT1G31335 unknown protein Potri.006G127000 4.47 0.8735
AT5G20510 Alfin AL5 alfin-like 5 (.1) Potri.018G050200 4.47 0.8524
AT4G19140 unknown protein Potri.001G130900 4.89 0.8670
Potri.010G058600 5.09 0.8438
AT5G60230 ATSEN2, SEN2 splicing endonuclease 2 (.1.2) Potri.009G131500 5.47 0.8412 Pt-SEN1.2
AT4G14000 Putative methyltransferase fam... Potri.001G321100 5.83 0.8821
AT3G05700 Drought-responsive family prot... Potri.013G011200 6.48 0.8634

Potri.006G024500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.