Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 124 / 8e-37 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 118 / 2e-34 Heavy metal transport/detoxification superfamily protein (.1) AT4G10465 116 / 1e-33 Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 100 / 1e-27 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT1G29100 100 / 1e-27 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 98 / 1e-26 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 94 / 6e-25 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 93 / 8e-25 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 87 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G065600 [exp] 141 / 1e-43 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G106500 [exp] 134 / 8e-41 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G452400 [exp] 130 / 4e-39 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G107500 [exp] 128 / 7e-39 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G056800 [exp] 126 / 8e-38 AT1G06330 147 / 4e-46 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G149500 [exp] 125 / 3e-37 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 105 / 2e-29 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 102 / 1e-28 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.007G087300 [exp] 102 / 2e-28 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033250 [exp] 134 / 3e-40 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1) Lus10008284 [exp] 132 / 1e-39 AT2G18196 246 / 4e-84 Heavy metal transport/detoxification superfamily protein (.1) Lus10028531 [exp] 108 / 1e-30 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10020704 [exp] 107 / 3e-30 AT1G06330 173 / 3e-56 Heavy metal transport/detoxification superfamily protein (.1) Lus10010147 [exp] 107 / 7e-30 AT2G18196 165 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1) Lus10009115 [exp] 106 / 9e-30 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10013911 [exp] 98 / 3e-26 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 96 / 9e-26 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10032446 [exp] 97 / 1e-25 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 96 / 1e-25 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.006G024800.2 pacid=42766982 polypeptide=Potri.006G024800.2.p locus=Potri.006G024800 ID=Potri.006G024800.2.v4.1 annot-version=v4.1 ATGTTTCAATGGCGATTTGGGAGGTCAAAATTATCCAACGCCTTGTCTACTGTGGAGCTCTTGGTACATATGGATTGTGAAGGATGTGAAAAGAGAATAC GAAGAGCAATCTCGAAAATTGATGGTGTTGATAGCTTGGAAATAGACATGGACAAGCAAAAGGTGACTGTAAAAGGGTATGTCGACCAGAGAAAGGTCCT GAAGGTAGTGAGAAGAACAGGAAGAAGAGCAGAGTTTTGGCCATTTCCATATGACAGTGAATATTATCCATATGCATCCCAATACTTGGATGAAACTACG TACATGACATCGTATAATTATTACAGACATGGGTTCAATGAAAGTGTTCATGGATACTTCCCAGACCAAGCTTACTGCACCGTCCCTGATGATACAGTCC ATCTTTTCAGTGATGACAATGTCCATGCATATTGTAGTATTATGTAA
AA sequence Show only first row Show all	>Potri.006G024800.2 pacid=42766982 polypeptide=Potri.006G024800.2.p locus=Potri.006G024800 ID=Potri.006G024800.2.v4.1 annot-version=v4.1 MFQWRFGRSKLSNALSTVELLVHMDCEGCEKRIRRAISKIDGVDSLEIDMDKQKVTVKGYVDQRKVLKVVRRTGRRAEFWPFPYDSEYYPYASQYLDETT YMTSYNYYRHGFNESVHGYFPDQAYCTVPDDTVHLFSDDNVHAYCSIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56891			Heavy metal transport/detoxifi...		Potri.006G024800 [exp]	0	1
AT2G23260		UGT84B1	UDP-glucosyl transferase 84B1 ...		Potri.007G049600 [exp]	3.46	0.9135
AT2G15620		ATHNIR, NIR1	ARABIDOPSIS THALIANA NITRITE R...		Potri.009G101600 [exp]	19.02	0.9271
AT4G04890	HD	PDF2	protodermal factor 2 (.1)		Potri.004G020400 [exp]	27.74	0.9023	ATML1.2
AT5G06370			NC domain-containing protein-r...		Potri.013G043100 [exp]	27.92	0.9265
					Potri.007G049700 [exp]	30.72	0.8554
AT4G31970		CYP82C2, JAH1	"cytochrome P450, family 82, s...		Potri.009G108766 [exp]	33.61	0.9218
					Potri.010G007844 [exp]	37.66	0.9142
AT5G49890		ATCLC-C, CLC-C	chloride channel C (.1)		Potri.018G138100 [exp]	37.94	0.8817
					Potri.018G033450 [exp]	44.07	0.8941
AT1G03670			ankyrin repeat family protein ...		Potri.018G077633 [exp]	49.47	0.9162

Compare expression of checked genes

Potri.006G024800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.