Potri.006G028200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58290 193 / 2e-60 RPT3 regulatory particle triple-A ATPase 3 (.1)
AT4G29040 55 / 4e-09 RPT2A regulatory particle AAA-ATPase 2A (.1)
AT2G20140 55 / 5e-09 RPT2b regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G029100 248 / 1e-84 AT5G58290 308 / 2e-105 regulatory particle triple-A ATPase 3 (.1)
Potri.006G031000 246 / 4e-81 AT5G58290 771 / 0.0 regulatory particle triple-A ATPase 3 (.1)
Potri.016G028000 234 / 1e-76 AT5G58290 781 / 0.0 regulatory particle triple-A ATPase 3 (.1)
Potri.002G252600 51 / 1e-07 AT4G29040 838 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Potri.014G194700 49 / 4e-07 AT4G29040 829 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006854 75 / 4e-16 AT5G58290 526 / 0.0 regulatory particle triple-A ATPase 3 (.1)
Lus10011901 50 / 2e-07 AT2G20140 844 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10022834 50 / 3e-07 AT2G20140 735 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10006976 48 / 1e-06 AT4G29040 828 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Lus10019995 47 / 2e-06 AT2G20140 827 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10000030 44 / 7e-06 AT4G29040 276 / 5e-93 regulatory particle AAA-ATPase 2A (.1)
Lus10001313 44 / 2e-05 AT4G29040 673 / 0.0 regulatory particle AAA-ATPase 2A (.1)
PFAM info
Representative CDS sequence
>Potri.006G028200.2 pacid=42770120 polypeptide=Potri.006G028200.2.p locus=Potri.006G028200 ID=Potri.006G028200.2.v4.1 annot-version=v4.1
ATGTCGACAATGGTACTTGACCTGAGACCCGCCGCGACAGTGGAGCCAAGATCGGACCTTGTACCCGACCCAACAGCAGTACCCACGGAAGACGACAACC
TCTACAGCCGCTTCAAATCTTTGCAAAGGCAGCTAGAATTCATTGACATACAAGAGGAGTATGTCAAGGATGAGCAGAAGAATCTGAAACGAGAGCTACT
TCGTGCGCAAGAAGAGGTGAAGCGGATCCAGTCGGTCCCGCTTGTAAGCGGGCAGTTTATGGAGATGGTGGATCAGAATAATGGGATTGTTGGGTCTACT
ACGGGTTCGAAGAATTATTATGTGAGGATTTTGAGTACGATTAATTGGGAATTGTTGAAGGCATCGACTTCTATGGCTTTGCATGGGCAATCGAATGCTC
TTGTTGATGTTTTGCCACCCAGGCTGATTCTAGTATTTCTCTGCTTAGTCAGAGTGAGAAACCTGATGTTACTTATAATGTATGTGAAAAAGTCTTTTTT
GGGGGGTTTTGGATTTGGGGTTTCTAAAATTGGTGATTTTGTGATTTGA
AA sequence
>Potri.006G028200.2 pacid=42770120 polypeptide=Potri.006G028200.2.p locus=Potri.006G028200 ID=Potri.006G028200.2.v4.1 annot-version=v4.1
MSTMVLDLRPAATVEPRSDLVPDPTAVPTEDDNLYSRFKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVSGQFMEMVDQNNGIVGST
TGSKNYYVRILSTINWELLKASTSMALHGQSNALVDVLPPRLILVFLCLVRVRNLMLLIMYVKKSFLGGFGFGVSKIGDFVI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G58290 RPT3 regulatory particle triple-A A... Potri.006G028200 0 1
AT5G13960 SDG33, KYP, SUV... SET DOMAIN PROTEIN 33, KRYPTON... Potri.014G143900 15.09 0.7022
Potri.001G296450 16.52 0.5368
AT1G56050 GTP-binding protein-related (.... Potri.011G143700 20.09 0.6893
AT5G50570 SBP SPL13, SPL13A SQUAMOSA PROMOTER-BINDING PROT... Potri.012G100700 23.15 0.6771
AT3G57290 ATINT6, ATEIF3E... eukaryotic translation initiat... Potri.016G043800 35.55 0.6639 EIF3.3
AT5G42655 Disease resistance-responsive ... Potri.002G131500 36.49 0.6769
AT3G11090 AS2 LBD21 LOB domain-containing protein ... Potri.008G071500 46.46 0.6624
Potri.017G139650 50.64 0.6590
AT3G48970 Heavy metal transport/detoxifi... Potri.015G144300 62.27 0.6670
AT1G30580 GTP binding (.1) Potri.001G465900 63.44 0.6513

Potri.006G028200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.