Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58290 308 / 2e-105 RPT3 regulatory particle triple-A ATPase 3 (.1) AT2G20140 110 / 1e-28 RPT2b regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1) AT4G29040 110 / 1e-28 RPT2A regulatory particle AAA-ATPase 2A (.1) AT5G43010 71 / 1e-14 RPT4A regulatory particle triple-A ATPase 4A (.1) AT1G45000 71 / 1e-14 AAA-type ATPase family protein (.1.2) AT1G09100 71 / 1e-14 RPT5B 26S proteasome AAA-ATPase subunit RPT5B (.1) AT3G05530 71 / 2e-14 ATS6A.2, RPT5A regulatory particle triple-A ATPase 5A (.1) AT5G20000 68 / 1e-13 RPT6A AAA-type ATPase family protein (.1) AT5G19990 68 / 2e-13 ATSUG1, RPT6A regulatory particle triple-A ATPase 6A (.1) AT1G53750 64 / 3e-12 RPT1A regulatory particle triple-A 1A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G031000 [exp] 340 / 8e-118 AT5G58290 771 / 0.0 regulatory particle triple-A ATPase 3 (.1) Potri.016G028000 [exp] 330 / 6e-114 AT5G58290 781 / 0.0 regulatory particle triple-A ATPase 3 (.1) Potri.006G028200 [exp] 209 / 2e-69 AT5G58290 193 / 2e-60 regulatory particle triple-A ATPase 3 (.1) Potri.002G252600 [exp] 109 / 4e-28 AT4G29040 838 / 0.0 regulatory particle AAA-ATPase 2A (.1) Potri.014G194700 [exp] 108 / 1e-27 AT4G29040 829 / 0.0 regulatory particle AAA-ATPase 2A (.1) Potri.004G158600 [exp] 72 / 4e-15 AT1G45000 752 / 0.0 AAA-type ATPase family protein (.1.2) Potri.005G231700 [exp] 72 / 7e-15 AT1G45000 756 / 0.0 AAA-type ATPase family protein (.1.2) Potri.002G031400 [exp] 72 / 8e-15 AT1G45000 745 / 0.0 AAA-type ATPase family protein (.1.2) Potri.013G016800 [exp] 71 / 1e-14 AT3G05530 800 / 0.0 regulatory particle triple-A ATPase 5A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022834 [exp] 109 / 5e-28 AT2G20140 735 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1) Lus10011901 [exp] 109 / 7e-28 AT2G20140 844 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1) Lus10006976 [exp] 106 / 4e-27 AT4G29040 828 / 0.0 regulatory particle AAA-ATPase 2A (.1) Lus10019995 [exp] 105 / 3e-26 AT2G20140 827 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1) Lus10001313 [exp] 101 / 2e-25 AT4G29040 673 / 0.0 regulatory particle AAA-ATPase 2A (.1) Lus10015524 [exp] 94 / 8e-23 AT2G20140 659 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1) Lus10017475 [exp] 74 / 1e-15 AT1G45000 759 / 0.0 AAA-type ATPase family protein (.1.2) Lus10028807 [exp] 74 / 1e-15 AT1G45000 748 / 0.0 AAA-type ATPase family protein (.1.2) Lus10041964 [exp] 74 / 2e-15 AT1G45000 752 / 0.0 AAA-type ATPase family protein (.1.2) Lus10017972 [exp] 74 / 2e-15 AT1G45000 756 / 0.0 AAA-type ATPase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G029100.2 pacid=42769252 polypeptide=Potri.006G029100.2.p locus=Potri.006G029100 ID=Potri.006G029100.2.v4.1 annot-version=v4.1 ATGTCGACAATGGTACTTGACCCGAGACCCGCCCCGACGGTGGAGCCAAGATCGGACCTTGTACCCGACCCAACAACAGTACCCACGGAAGACGACGACC TCTACAGCCGCTTAAAATCTCTGCAACGACAGCTAGAATTCATCGACATACAAGAGGAGTATGTCAAGGATGAGCAGAAGAATCTGAAGCGAGAGCTACT TCGTGCGCAAGAAGAGGTGAAGCGGATCCAGTCGGTGCCGCTTGTGATCGGGCAGTTTATGGAGATGGTGGATCAGACTAATGGGATTGTTGGGTCTACT ACGGGTTCGAATTATTATGTGAGGATTTTGAGTACGATTGATAGGGAATTGTTGAAGCCGTCGGCTTCTGTGGCTTTGCATCGGCATTCGAATGCTCTTG TTGATGTTTTGCCACCTGAGGCTGATTCTAGTATTTCTCTGCTTAGTCAGAGTGAGAAACCTGATGTTACTTATAATGACATTGGAGGTTGTGACATTCA AAAGCAGGAAATTCGTGAGGCGGTTGAGATGCCACTGACTCACCATGAACTTTACAAACAAATTACATGA
AA sequence Show only first row Show all	>Potri.006G029100.2 pacid=42769252 polypeptide=Potri.006G029100.2.p locus=Potri.006G029100 ID=Potri.006G029100.2.v4.1 annot-version=v4.1 MSTMVLDPRPAPTVEPRSDLVPDPTTVPTEDDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQTNGIVGST TGSNYYVRILSTIDRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVEMPLTHHELYKQIT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G58290		RPT3	regulatory particle triple-A A...		Potri.006G029100 [exp]	0	1
AT4G01810			Sec23/Sec24 protein transport ...		Potri.014G112600 [exp]	1.41	0.8205
AT1G16970		KU70, ATKU70	ARABIDOPSIS THALIANA KU70 HOMO...		Potri.011G107400 [exp]	2.44	0.7860	Pt-KU70.1
					Potri.015G135100 [exp]	3.16	0.8437
AT5G43960			Nuclear transport factor 2 (NT...		Potri.002G257000 [exp]	7.07	0.7889
AT3G50120			Plant protein of unknown funct...		Potri.016G039733 [exp]	11.13	0.8026
AT4G26550			Got1/Sft2-like vescicle transp...		Potri.014G170700 [exp]	12.12	0.8194
AT1G55150			DEA(D/H)-box RNA helicase fami...		Potri.013G158000 [exp]	14.00	0.7277	Pt-P68.2
AT2G33150		PED1, KAT2, PKT...	PEROXISOME DEFECTIVE 1, 3-KETO...		Potri.001G051800 [exp]	15.23	0.7799
AT2G01690			ARM repeat superfamily protein...		Potri.008G134600 [exp]	17.74	0.7700
AT3G54070			Ankyrin repeat family protein ...		Potri.014G058100 [exp]	27.45	0.7745

Compare expression of checked genes

Potri.006G029100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.