Potri.006G032000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12390 216 / 2e-71 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
AT5G13850 210 / 2e-69 NACA3 nascent polypeptide-associated complex subunit alpha-like protein 3 (.1)
AT3G49470 206 / 2e-67 NACA2 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
AT4G10480 196 / 2e-63 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1), Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.2)
AT1G33040 191 / 8e-62 NACA5 nascent polypeptide-associated complex subunit alpha-like protein 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G190800 265 / 9e-91 AT3G12390 204 / 7e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.001G034400 257 / 7e-88 AT3G12390 204 / 5e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.015G003300 204 / 1e-66 AT3G49470 172 / 4e-54 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Potri.012G006700 191 / 2e-61 AT3G49470 171 / 1e-53 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041610 234 / 8e-79 AT3G12390 229 / 7e-77 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10026133 220 / 3e-74 AT3G12390 204 / 2e-68 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10024109 206 / 1e-68 AT3G12390 198 / 1e-65 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10008687 210 / 8e-67 AT3G15660 197 / 7e-62 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2)
Lus10032927 198 / 2e-64 AT3G49470 260 / 2e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Lus10015579 198 / 3e-64 AT3G49470 260 / 1e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Potri.006G032000.1 pacid=42769940 polypeptide=Potri.006G032000.1.p locus=Potri.006G032000 ID=Potri.006G032000.1.v4.1 annot-version=v4.1
ATGACGACTGCTCAGTCTCAAGAAGAACTCCTTGCTGCTCATCTTGAACAACAAGAACTCAAACATGGTGAGCCTACAGTTGAGGACGAAGATGATGAGG
ATGAATCTGATGAGGATGACGATGATTATGATGACAAGGATGATGAAGGGAAAGGAGATGTGGGCGGCCGGGGTAAGCAGAGCAGAAGTGAAAAGAAGAG
TCGTAAGGCAATGCTGAAACTTGGAATGAAGCCACTCCCAGGTGTCAGCCGAGTTACAGTAAAAAAGAGCAAGAATATCATGTTTGTTATCTCAAAACCT
GATGTTTTCAAGAGCCCCAATTCAGACACATACATTGTCTTTGGGGAAGCAAAGATTGAGGACTTGAGCTCCCAACTACAGACCCAGGCTGCTGAGCAGT
TCAAGGCACCTAATCCAAGTACTTCCGCATCACAGCCTGAGCCATCGTCCACGGCTCAAGATGATGAAGATGTAGACGAGACTGGTGTGGAGCCCAAGGA
TATTGAGTTGGTGATGACACAAGCCGGGGTTTCCAGATCAAAGGCTGTGAAAGCTCTCAAGGCTGCAGATGGTGATATCGTTACTGCCATCATGGAATTA
ACAAACTGA
AA sequence
>Potri.006G032000.1 pacid=42769940 polypeptide=Potri.006G032000.1.p locus=Potri.006G032000 ID=Potri.006G032000.1.v4.1 annot-version=v4.1
MTTAQSQEELLAAHLEQQELKHGEPTVEDEDDEDESDEDDDDYDDKDDEGKGDVGGRGKQSRSEKKSRKAMLKLGMKPLPGVSRVTVKKSKNIMFVISKP
DVFKSPNSDTYIVFGEAKIEDLSSQLQTQAAEQFKAPNPSTSASQPEPSSTAQDDEDVDETGVEPKDIELVMTQAGVSRSKAVKALKAADGDIVTAIMEL
TN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G12390 Nascent polypeptide-associated... Potri.006G032000 0 1
AT3G07930 DNA glycosylase superfamily pr... Potri.014G189400 2.82 0.7268
AT5G59970 Histone superfamily protein (.... Potri.007G013300 5.00 0.6854
AT2G02470 Alfin AL6 alfin-like 6 (.1.2) Potri.004G230500 9.89 0.6576
AT5G38720 unknown protein Potri.017G108700 12.84 0.7080
AT5G54880 DTW domain-containing protein ... Potri.001G423900 14.69 0.6796
AT2G02470 Alfin AL6 alfin-like 6 (.1.2) Potri.003G044700 19.74 0.6574
AT5G17900 microfibrillar-associated prot... Potri.019G039900 20.04 0.6831
AT1G04230 Protein of unknown function (D... Potri.010G078500 31.43 0.6584
AT3G15080 Polynucleotidyl transferase, r... Potri.001G373500 35.72 0.6452
AT2G30260 U2B'' U2 small nuclear ribonucleopro... Potri.013G153700 37.45 0.6452

Potri.006G032000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.