Plant FIBer expression Database

Potri.006G038201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G037000
[exp]
62 / 2e-14 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.006G038201.1 pacid=42770038 polypeptide=Potri.006G038201.1.p locus=Potri.006G038201 ID=Potri.006G038201.1.v4.1 annot-version=v4.1
ATGAAGCATTATTGTATGGTGAAGAGTTTGATGTTCAAGTGTTTCAGCTTGAGATCAATAATCTTTCTTGTTTTCTTGACCATGTTGCTTGTGTTGCTGC
CGTTGATGTTGCCACCATTGCCGCCACCTCCATCAATACTCATGTTTCTTCCAGTTTTGATCATGTCCTTTCTAATTTTGTTGGCCTTCTCTTCGTCTCA
AATCCCTCATATTGCACTGCACTCTTCTACATGA
AA sequence
>Potri.006G038201.1 pacid=42770038 polypeptide=Potri.006G038201.1.p locus=Potri.006G038201 ID=Potri.006G038201.1.v4.1 annot-version=v4.1
MKHYCMVKSLMFKCFSLRSIIFLVFLTMLLVLLPLMLPPLPPPPSILMFLPVLIMSFLILLAFSSSQIPHIALHSST

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G038201
[exp]
0 1
AT4G00870 bHLH bHLH014 basic helix-loop-helix (bHLH) ... Potri.001G083500
[exp]
5.29 0.8744
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Potri.010G072300
[exp]
5.65 0.8338 Pt-ERF1.2,ERF33
AT4G11280 ATACS6, ACS6 1-aminocyclopropane-1-carboxyl... Potri.003G132300
[exp]
9.05 0.8775 Pt-ACS2.2
AT2G35215 unknown protein Potri.003G092100
[exp]
9.16 0.8124
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Potri.009G142000
[exp]
9.69 0.9087
AT4G00870 bHLH bHLH014 basic helix-loop-helix (bHLH) ... Potri.003G147300
[exp]
16.79 0.8747
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Potri.010G184400
[exp]
17.14 0.7829
AT2G29060 GRAS GRAS family transcription fact... Potri.001G242000
[exp]
25.45 0.7868
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Potri.009G142300
[exp]
30.82 0.8169
AT5G01210 HXXXD-type acyl-transferase fa... Potri.016G112400
[exp]
32.07 0.8361

Potri.006G038201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.