Potri.006G038250 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G058050 45 / 1e-07 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.006G038250.1 pacid=42768639 polypeptide=Potri.006G038250.1.p locus=Potri.006G038250 ID=Potri.006G038250.1.v4.1 annot-version=v4.1
ATGCTATTTCATTACACCAATTTGGTTGTGTTTCCTGAGATGTCTACGCAACCTGATGCATTATACTCCTGGTATCCAAGACAGAATCAATTGATTAATT
ACTTGGTATGGAAAGCTCAGAAAGCAGCAACGACTATCCGTGAAAGTGTTGATGAGATAGGATATATTGTGGCCAACACCACGCTTAATTTATGTCGTGC
AAACTTCAAGAGATTGAGGTTGAGCATCTTTAAGTAG
AA sequence
>Potri.006G038250.1 pacid=42768639 polypeptide=Potri.006G038250.1.p locus=Potri.006G038250 ID=Potri.006G038250.1.v4.1 annot-version=v4.1
MLFHYTNLVVFPEMSTQPDALYSWYPRQNQLINYLVWKAQKAATTIRESVDEIGYIVANTTLNLCRANFKRLRLSIFK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G038250 0 1
AT1G09155 ATPP2-B15 phloem protein 2-B15 (.1) Potri.005G022000 5.38 0.9888
AT3G11840 PUB24 plant U-box 24 (.1) Potri.009G016100 9.27 0.9863
AT5G05600 2-oxoglutarate (2OG) and Fe(II... Potri.006G101200 11.48 0.9848
AT2G26530 AR781 Protein of unknown function (D... Potri.002G128500 12.96 0.9793
AT5G52400 CYP715A1 "cytochrome P450, family 715, ... Potri.015G145100 13.26 0.9847
AT1G68620 alpha/beta-Hydrolases superfam... Potri.008G118400 14.83 0.9845
AT1G09155 ATPP2-B15 phloem protein 2-B15 (.1) Potri.013G012600 16.12 0.9708
AT5G05600 2-oxoglutarate (2OG) and Fe(II... Potri.006G101100 16.24 0.9842
AT5G25880 ATNADP-ME3 Arabidopsis thaliana NADP-mali... Potri.006G236500 19.59 0.9714
Potri.007G014501 19.89 0.9836

Potri.006G038250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.