Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41180 56 / 1e-10 SIB2 sigma factor binding protein 2, VQ motif-containing protein (.1) AT3G56710 56 / 2e-10 SIB1 sigma factor binding protein 1 (.1) AT1G17147 38 / 0.0005 VQ motif-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G036600 [exp] 197 / 7e-66 AT3G56710 48 / 2e-07 sigma factor binding protein 1 (.1) Potri.001G029700 [exp] 68 / 4e-15 AT3G56710 54 / 5e-10 sigma factor binding protein 1 (.1) Potri.003G194700 [exp] 62 / 9e-13 AT3G56710 54 / 6e-10 sigma factor binding protein 1 (.1) Potri.019G013750 [exp] 55 / 3e-10 AT3G56710 46 / 7e-07 sigma factor binding protein 1 (.1) Potri.013G043800 [exp] 55 / 4e-10 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.016G093900 [exp] 54 / 6e-10 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.019G013300 [exp] 54 / 7e-10 AT2G41180 47 / 3e-07 sigma factor binding protein 2, VQ motif-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038985 [exp] 60 / 2e-11 AT3G56710 54 / 3e-09 sigma factor binding protein 1 (.1) Lus10024139 [exp] 57 / 8e-11 AT3G56710 58 / 5e-11 sigma factor binding protein 1 (.1) Lus10039494 [exp] 56 / 2e-10 AT3G56710 56 / 3e-10 sigma factor binding protein 1 (.1) Lus10039493 [exp] 55 / 8e-10 AT3G56710 54 / 1e-09 sigma factor binding protein 1 (.1) Lus10005523 [exp] 53 / 4e-09 ND 46 / 2e-06 Lus10006569 [exp] 51 / 2e-08 ND 44 / 1e-05 Lus10022005 [exp] 48 / 2e-07 AT3G56710 48 / 1e-07 sigma factor binding protein 1 (.1) Lus10026165 [exp] 47 / 3e-07 AT3G56710 44 / 3e-06 sigma factor binding protein 1 (.1) Lus10008659 [exp] 46 / 1e-06 ND 44 / 4e-06
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05678 [poplar] [flax] VQ VQ motif
Representative CDS sequence Show only first row Show all	>Potri.006G038900.1 pacid=42769499 polypeptide=Potri.006G038900.1.p locus=Potri.006G038900 ID=Potri.006G038900.1.v4.1 annot-version=v4.1 ATGGATAACAATCATAGTCACTCGGTAGGTGGTGGTGTGCAAGAAAAAAAAGCACACAGAATTGCCGGAACCGGAACCAAGAAAAAGCCTATGAAAGTAG TTTACATATCCAACCCCATGAAGTTCAAGGCTAGTGCATCTGAATTTAGGGCTCTGGTTCAAGAACTCACTGGTCAAGATTCTGAATTGCCAGACCCTAG TAAGTTCGTGGACAGTGATGGCCATGATCGTGATGTCGGTGGAAATTATCAAACGGTTCCGAATGCTTCTAAGAGTGTTGTTGTTGATGGTGGTCATGCA CAAGAAGTTCCCATAGAGGATCCTAGTCAAGTGCAGCCTGAAAGACAAGATGCCCCATTTGAGTCTTTTGATGATGTTTTCATGCCTCAGATGTTGGAGG ATATTTCAGAGAAAATGCCATCAAAATTATGGTATGAAGCTTATAACTCATGGATGTACTCTTGA
AA sequence Show only first row Show all	>Potri.006G038900.1 pacid=42769499 polypeptide=Potri.006G038900.1.p locus=Potri.006G038900 ID=Potri.006G038900.1.v4.1 annot-version=v4.1 MDNNHSHSVGGGVQEKKAHRIAGTGTKKKPMKVVYISNPMKFKASASEFRALVQELTGQDSELPDPSKFVDSDGHDRDVGGNYQTVPNASKSVVVDGGHA QEVPIEDPSQVQPERQDAPFESFDDVFMPQMLEDISEKMPSKLWYEAYNSWMYS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G41180		SIB2	sigma factor binding protein 2...		Potri.006G038900 [exp]	0	1
AT5G54190		PORA	protochlorophyllide oxidoreduc...		Potri.011G122400 [exp]	1.41	0.8940	Pt-PORA.1
AT1G79040		PSBR	photosystem II subunit R (.1)		Potri.001G438800 [exp]	2.82	0.8707	Pt-PP1.2
AT2G45400		BEN1	NAD(P)-binding Rossmann-fold s...		Potri.002G147602 [exp]	8.48	0.8893
AT4G27220			NB-ARC domain-containing disea...		Potri.011G124366 [exp]	10.19	0.9008
AT4G24275			unknown protein		Potri.003G006100 [exp]	16.97	0.8418
AT1G60600		ABC4	ABERRANT CHLOROPLAST DEVELOPME...		Potri.017G050900 [exp]	19.44	0.8547
AT4G27220			NB-ARC domain-containing disea...		Potri.011G124212 [exp]	20.49	0.8932
AT1G14590			Nucleotide-diphospho-sugar tra...		Potri.008G142200 [exp]	23.23	0.8575
AT4G24790			AAA-type ATPase family protein...		Potri.012G091700 [exp]	25.39	0.8767
AT4G38620	MYB	AtMYB4	myb domain protein 4 (.1)		Potri.005G112000 [exp]	28.84	0.8408

Compare expression of checked genes

Potri.006G038900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.