Potri.006G041900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57090 215 / 3e-72 FIS1A, BIGYIN FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G12390 164 / 4e-52 FIS1B FISSION 1B, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G41360 0 / 1 Galactose oxidase/kelch repeat superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G038900 268 / 3e-93 AT3G57090 216 / 1e-72 FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G047300 205 / 1e-68 AT3G57090 203 / 9e-68 FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009706 214 / 1e-71 AT3G57090 237 / 6e-81 FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036023 198 / 4e-65 AT3G57090 223 / 1e-74 FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10009707 101 / 8e-29 AT5G12390 96 / 6e-27 FISSION 1B, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
CL0020 TPR PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Representative CDS sequence
>Potri.006G041900.1 pacid=42770105 polypeptide=Potri.006G041900.1.p locus=Potri.006G041900 ID=Potri.006G041900.1.v4.1 annot-version=v4.1
ATGGAAGCGAAGATCAGAGGGGCCTTCGAGTCCGTCGGTTCCTTCTTCACCGGCGGCGATCATATCCCATGGTGCGACCGTGACATAATTACTGGCTGTG
AGAGGGAGGTTGCAGAAGCTGCTGAGGGTGACTCAGAGGAACTTAAAAGGGATACCATAATGCGATTGTCATGGGCTCTTGTTCACTCTAAACAACCAGA
AGATGTGCAGCGTGGGATAGCTATGCTTGAAGCATCATTGGCAAATAGTAGCCCCCCTTTGCTACAGAGAGAGAAGATTTATCTTCTGGCCGTGGGATAT
TACAGAAGTGGTGAATATTCAAGGAGCAGGCAGCTGGTGGACCAGTGTTTGGAGATTGCACCTGATTGGAGGCAGGCTTTGGTCCTGAAGAAGACACTTG
AAGATCGAGTTGCTAAAGATGGTGTTATTGGAATAGGCATCGCTGCTACTGCCGTGGGACTGATAGCTGGTGGAATTGCTGCAGCATTGGCTCGCAAGAA
ATGA
AA sequence
>Potri.006G041900.1 pacid=42770105 polypeptide=Potri.006G041900.1.p locus=Potri.006G041900 ID=Potri.006G041900.1.v4.1 annot-version=v4.1
MEAKIRGAFESVGSFFTGGDHIPWCDRDIITGCEREVAEAAEGDSEELKRDTIMRLSWALVHSKQPEDVQRGIAMLEASLANSSPPLLQREKIYLLAVGY
YRSGEYSRSRQLVDQCLEIAPDWRQALVLKKTLEDRVAKDGVIGIGIAATAVGLIAGGIAAALARKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G57090 FIS1A, BIGYIN FISSION 1A, Tetratricopeptide ... Potri.006G041900 0 1
AT5G62740 AtHIR4, ATHIR1 hypersensitive induced reactio... Potri.017G078000 2.23 0.8470
AT5G42890 ATSCP2 sterol carrier protein 2 (.1) Potri.002G126200 6.48 0.7811
AT4G21580 oxidoreductase, zinc-binding d... Potri.004G036100 9.16 0.8093
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Potri.011G168200 10.58 0.8352 UBC.8
AT5G64830 programmed cell death 2 C-term... Potri.007G080500 19.89 0.7658
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Potri.013G076600 22.80 0.8202 Pt-CYP89.2
AT5G58800 Quinone reductase family prote... Potri.009G044400 30.09 0.8110
AT4G04210 PUX4 plant UBX domain containing pr... Potri.011G011300 34.20 0.7496
AT4G16745 Exostosin family protein (.1.2... Potri.003G079000 49.04 0.7564
Potri.006G102900 51.96 0.7966

Potri.006G041900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.