Potri.006G044300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G041301 120 / 2e-37 ND /
Potri.006G044200 46 / 4e-08 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042010 71 / 5e-18 ND /
Lus10018014 64 / 3e-15 ND /
Lus10018015 63 / 1e-14 ND /
Lus10042011 60 / 2e-13 ND /
Lus10031026 54 / 5e-11 ND /
PFAM info
Representative CDS sequence
>Potri.006G044300.1 pacid=42767558 polypeptide=Potri.006G044300.1.p locus=Potri.006G044300 ID=Potri.006G044300.1.v4.1 annot-version=v4.1
ATGGCTGGTCTTCAGTACAACTTCTTCCCCACAGATTTCTTCTACCCGCGTCCACAAACTGTGAAAGTAGACACCGCCGCCACCACCACACAGAAAAGCG
CCGCTCTTCCCTTGCAGATTCAAGAGCGAGAAGTCATGATCACTGATGATCTTAAGCCCAAACACCACCCCGCAAGCTTAGTTTTACACAACAACAAGCA
TGGCCACAAGATCGGTACTCCCATGAACAAGCGCACTGCATGA
AA sequence
>Potri.006G044300.1 pacid=42767558 polypeptide=Potri.006G044300.1.p locus=Potri.006G044300 ID=Potri.006G044300.1.v4.1 annot-version=v4.1
MAGLQYNFFPTDFFYPRPQTVKVDTAATTTQKSAALPLQIQEREVMITDDLKPKHHPASLVLHNNKHGHKIGTPMNKRTA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G044300 0 1
AT1G07250 UGT71C4 UDP-glucosyl transferase 71C4 ... Potri.016G014300 3.31 0.9069
AT1G20696 NFD3, NFD03, HM... high mobility group B3 (.1.2.3... Potri.005G101400 4.00 0.8998 HMGB915
AT3G25070 RIN4 RPM1 interacting protein 4 (.1... Potri.002G245400 6.24 0.8927 RIN4.1
AT1G20070 unknown protein Potri.002G019700 6.32 0.8819
AT2G39210 Major facilitator superfamily ... Potri.008G032901 6.92 0.8880
AT1G75170 Sec14p-like phosphatidylinosit... Potri.005G123200 7.34 0.8827
AT3G47500 DOF CDF3, AtDof3,3 cycling DOF factor 3 (.1) Potri.010G167600 10.81 0.8715
AT2G31305 INH3 inhibitor-3 (.1) Potri.005G067400 12.48 0.8905
AT1G69310 WRKY ATWRKY57, WRKY5... WRKY DNA-binding protein 57 (.... Potri.008G094000 14.69 0.8860
AT3G19950 RING/U-box superfamily protein... Potri.015G028400 15.19 0.8797

Potri.006G044300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.