Plant FIBer expression Database

Potri.006G045601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41460 71 / 6e-16 ARP apurinic endonuclease-redox protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G042000
[exp]
0 / 1 AT2G41460 590 / 0.0 apurinic endonuclease-redox protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000437
[exp]
0 / 1 AT2G41460 541 / 0.0 apurinic endonuclease-redox protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.006G045601.1 pacid=42768356 polypeptide=Potri.006G045601.1.p locus=Potri.006G045601 ID=Potri.006G045601.1.v4.1 annot-version=v4.1
ATGGATTTGTGGATGCCTTCAGAAAACAGCATCCCAATGTTGTTGGGTATACCTACTGGGGTTATCGACATGGTGGTCGGAAAACTAACAAAGTTTGAAA
CAGGATGGCGGCTTGACTACTTTCTTGTGTCAGAATCCATAGCAGACAACGTCCATGACTCCTACATTGTCCCTGCTGTTACTGGGGGTGATCACTGTCC
TCTTCGCCCTGTACTCGAGCTTTAG
AA sequence
>Potri.006G045601.1 pacid=42768356 polypeptide=Potri.006G045601.1.p locus=Potri.006G045601 ID=Potri.006G045601.1.v4.1 annot-version=v4.1
MDLWMPSENSIPMLLGIPTGVIDMVVGKLTKFETGWRLDYFLVSESIADNVHDSYIVPAVTGGDHCPLRPVLEL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G41460 ARP apurinic endonuclease-redox pr... Potri.006G045601
[exp]
0 1
AT5G24090 ATCHIA chitinase A (.1) Potri.002G165700
[exp]
8.83 0.9021 CHI3.11
AT3G28960 Transmembrane amino acid trans... Potri.008G086500
[exp]
12.64 0.9005
AT4G30460 glycine-rich protein (.1) Potri.006G178200
[exp]
16.52 0.8892
AT1G43650 nodulin MtN21 /EamA-like trans... Potri.002G068300
[exp]
16.91 0.8842
AT1G64070 RLM1 RESISTANCE TO LEPTOSPHAERIA MA... Potri.006G284000
[exp]
18.33 0.8819
Potri.013G007900
[exp]
18.33 0.8922
AT2G38400 AGT3 alanine:glyoxylate aminotransf... Potri.016G132200
[exp]
18.73 0.8210 AGT3.1
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Potri.006G179300
[exp]
20.00 0.8878
AT3G53980 Bifunctional inhibitor/lipid-t... Potri.016G104300
[exp]
21.42 0.8856
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Potri.016G057400
[exp]
23.64 0.8806

Potri.006G045601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.