Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G51510 134 / 1e-39 Y14 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G11400 53 / 1e-08 ATEIF3G1, EIF3G1 eukaryotic translation initiation factor 3G1 (.1.2) AT5G06000 49 / 5e-07 ATEIF3G2, EIF3G2 ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITIATION FACTOR 3G2, eukaryotic translation initiation factor 3G2 (.1) AT5G64200 48 / 1e-06 ATSC35, At-SC35 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) AT2G21440 48 / 1e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G27000 47 / 4e-06 ATRBP45C RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G51300 47 / 4e-06 splicing factor-related (.1.2.3) AT3G50670 46 / 6e-06 U1SNRNP, U1-70K U1 small nuclear ribonucleoprotein-70K (.1.2) AT1G73530 45 / 8e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G47120 45 / 1e-05 C3HZnF RNA recognition motif (RRM)-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G051000 [exp] 134 / 1e-39 AT1G51510 248 / 2e-84 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G255600 [exp] 130 / 2e-38 AT1G51510 230 / 3e-77 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G060000 [exp] 57 / 9e-10 AT3G11400 422 / 5e-150 eukaryotic translation initiation factor 3G1 (.1.2) Potri.010G199000 [exp] 54 / 1e-08 AT3G11400 422 / 4e-150 eukaryotic translation initiation factor 3G1 (.1.2) Potri.003G023800 [exp] 51 / 9e-08 AT5G64200 207 / 4e-66 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) Potri.009G044900 [exp] 50 / 2e-07 AT3G47120 276 / 8e-91 RNA recognition motif (RRM)-containing protein (.1) Potri.002G095800 [exp] 47 / 1e-06 AT5G64200 204 / 5e-65 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) Potri.001G126400 [exp] 48 / 2e-06 AT5G51300 790 / 0.0 splicing factor-related (.1.2.3) Potri.003G149600 [exp] 47 / 2e-06 AT4G19610 646 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009963 [exp] 133 / 7e-39 AT1G51510 265 / 3e-90 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003632 [exp] 130 / 2e-37 AT1G51510 260 / 3e-88 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10030482 [exp] 55 / 4e-09 AT3G11400 459 / 9e-165 eukaryotic translation initiation factor 3G1 (.1.2) Lus10028823 [exp] 55 / 6e-09 AT3G11400 459 / 9e-165 eukaryotic translation initiation factor 3G1 (.1.2) Lus10017459 [exp] 53 / 2e-08 AT3G11400 447 / 3e-160 eukaryotic translation initiation factor 3G1 (.1.2) Lus10038932 [exp] 51 / 1e-07 AT5G51300 897 / 0.0 splicing factor-related (.1.2.3) Lus10003957 [exp] 51 / 1e-07 AT5G64200 217 / 9e-70 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) Lus10023802 [exp] 50 / 2e-07 AT5G64200 217 / 1e-68 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) Lus10040854 [exp] 44 / 4e-06 AT3G46020 112 / 1e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10042589 [exp] 47 / 5e-06 AT2G21440 825 / 0.0 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.006G048300.3 pacid=42770307 polypeptide=Potri.006G048300.3.p locus=Potri.006G048300 ID=Potri.006G048300.3.v4.1 annot-version=v4.1 ATGAGAGGCAGAGTCATGGTAGACGAAGACAACGGCGACGTCGTGATGACGGAACAGCCAAGAGGAAGAGGAAGAGAAAGGCGCAAAGGCAGAGGTCTCA GACTCGGAGGACGAGGAGAATCAAGGCAACAGACACTACTCCATGACGAAGAAGAAGAGGAAGAGGGTGGGAATGACCGAAATGTCCTTCAACTCTTCAC TCCTCTTCGCTCTGTAGAGGGTTGGAGTGTTTTGTTGAGTGGAGTGCATGAAGAAGCACAAGAAGATGATATTCTCACTCTATTTGGTGCTTTTGGCCAC ATCAACAACTTGCATCTCAATCTTGATCGCCGCACCGGATTTCTTAAGGGGTATGCTCTGATAGAATATGAGAACTTTATGGAAGCTCAAGCTGCTATAT CTGGAATGAATGGGACTAAACTCTTCTTTCGGATCATCTCTGTTGACTGGGCTTTCAGCACTGGTCCTTTCGAAGGGAGAAGGTCTGCTTGTTTTCATGA ATTATCATATGCTATAGCTATATTTGGTGTTAGCCTAACCTGTAACCCTTTCTCAGCTTGA
AA sequence Show only first row Show all	>Potri.006G048300.3 pacid=42770307 polypeptide=Potri.006G048300.3.p locus=Potri.006G048300 ID=Potri.006G048300.3.v4.1 annot-version=v4.1 MRGRVMVDEDNGDVVMTEQPRGRGRERRKGRGLRLGGRGESRQQTLLHDEEEEEEGGNDRNVLQLFTPLRSVEGWSVLLSGVHEEAQEDDILTLFGAFGH INNLHLNLDRRTGFLKGYALIEYENFMEAQAAISGMNGTKLFFRIISVDWAFSTGPFEGRRSACFHELSYAIAIFGVSLTCNPFSA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G51510		Y14	RNA-binding (RRM/RBD/RNP motif...		Potri.006G048300 [exp]	0	1
					Potri.009G025001 [exp]	2.44	0.8893
					Potri.002G048450 [exp]	3.31	0.8949
AT2G16920		UBC23 ,PFU2	PHO2 FAMILY UBIQUITIN CONJUGAT...		Potri.013G108500 [exp]	8.83	0.8415
					Potri.002G066300 [exp]	10.58	0.8483
AT1G67750			Pectate lyase family protein (...		Potri.010G051800 [exp]	11.48	0.7879
AT2G24400			SAUR-like auxin-responsive pro...		Potri.006G278100 [exp]	12.36	0.8152
					Potri.001G360550 [exp]	12.96	0.8093
AT1G02810			Plant invertase/pectin methyle...		Potri.002G202600 [exp]	14.49	0.8248
AT5G35770		SAP	STERILE APETALA, Transducin/WD...		Potri.014G166400 [exp]	19.49	0.8107	SAP.1
AT1G24520		BCP1	homolog of Brassica campestris...		Potri.012G095900 [exp]	19.59	0.7148

Compare expression of checked genes

Potri.006G048300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.