Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57450 59 / 4e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G055901 [exp] 101 / 5e-30 AT3G57450 70 / 2e-17 unknown protein Potri.001G263404 [exp] 62 / 2e-14 AT3G57450 64 / 3e-15 unknown protein Potri.009G058500 [exp] 54 / 4e-11 AT3G57450 47 / 1e-08 unknown protein Potri.012G032500 [exp] 52 / 3e-10 AT3G57450 66 / 2e-15 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031071 [exp] 67 / 2e-16 AT3G57450 69 / 5e-17 unknown protein Lus10035455 [exp] 67 / 2e-16 AT3G57450 69 / 3e-17 unknown protein Lus10018070 [exp] 64 / 7e-15 AT3G57450 66 / 1e-15 unknown protein Lus10042063 [exp] 63 / 2e-14 AT3G57450 67 / 1e-15 unknown protein Lus10029496 [exp] 57 / 1e-12 AT3G57450 64 / 6e-15 unknown protein Lus10019730 [exp] 51 / 5e-10 AT3G57450 66 / 8e-16 unknown protein Lus10016391 [exp] 51 / 6e-10 AT3G57450 66 / 1e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G050800.1 pacid=42768093 polypeptide=Potri.006G050800.1.p locus=Potri.006G050800 ID=Potri.006G050800.1.v4.1 annot-version=v4.1 ATGGGGTTGTTAGATTCTGGGGTAAGAATAGCTGGAAGATTTTACTCTCACTGCCCACAAACTGCTCGCTTGTACTACCATCCTCCCTCTAACTCCGATG ACCTCCACCACCACCAGCAGCAGCAGCGCCATGGCCACAACGGTGGCAGCGAGAGTCAGGCGCCGACTCGAGGCTCTTCTCGGGGGGCCAGTTGTGGAGT CAAGGCGGCGAAGGGCTTAGATACTATTGACATAGTCTTCTATTCAGTCATGTAA
AA sequence Show only first row Show all	>Potri.006G050800.1 pacid=42768093 polypeptide=Potri.006G050800.1.p locus=Potri.006G050800 ID=Potri.006G050800.1.v4.1 annot-version=v4.1 MGLLDSGVRIAGRFYSHCPQTARLYYHPPSNSDDLHHHQQQQRHGHNGGSESQAPTRGSSRGASCGVKAAKGLDTIDIVFYSVM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G57450			unknown protein		Potri.006G050800 [exp]	0	1
AT1G23710			Protein of unknown function (D...		Potri.010G041300 [exp]	1.00	0.9694
					Potri.005G087400 [exp]	2.44	0.9533
AT4G24570		DIC2	dicarboxylate carrier 2 (.1)		Potri.007G113000 [exp]	3.87	0.9404
AT5G59820	C2H2ZnF	ZAT12, RHL41	RESPONSIVE TO HIGH LIGHT 41, C...		Potri.009G027700 [exp]	3.87	0.9368	RHL41.1
AT5G22250		AtCAF1b	CCR4- associated factor 1b, Po...		Potri.004G200400 [exp]	4.00	0.9368
AT1G21010			unknown protein		Potri.005G259100 [exp]	4.24	0.9356
AT1G76650		CML38	calmodulin-like 38 (.1.2.3)		Potri.005G259900 [exp]	5.19	0.9118
AT5G67080		MAPKKK19	mitogen-activated protein kina...		Potri.005G139300 [exp]	6.48	0.9352
AT5G51190	AP2_ERF		Integrase-type DNA-binding sup...		Potri.003G150800 [exp]	7.48	0.9330	ERF5
AT1G25560	AP2_ERF	EDF1, TEM1	TEMPRANILLO 1, ETHYLENE RESPON...		Potri.010G129200 [exp]	8.48	0.9090	RAV2.2,RAV1

Compare expression of checked genes

Potri.006G050800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.