Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20898 67 / 2e-15 unknown protein AT1G51355 62 / 1e-13 unknown protein AT3G20900 56 / 9e-12 unknown protein AT1G60783 44 / 7e-07 unknown protein AT5G40460 42 / 1e-05 unknown protein AT5G02220 39 / 4e-05 unknown protein AT1G10690 39 / 0.0001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G053900 [exp] 130 / 9e-41 AT3G20898 68 / 5e-16 unknown protein Potri.001G257700 [exp] 84 / 5e-22 AT3G20898 78 / 1e-19 unknown protein Potri.009G053000 [exp] 81 / 1e-20 AT3G20898 76 / 9e-19 unknown protein Potri.008G029600 [exp] 49 / 1e-08 AT5G02420 48 / 5e-08 unknown protein Potri.010G231600 [exp] 45 / 3e-07 AT5G02420 44 / 1e-06 unknown protein Potri.010G045200 [exp] 45 / 4e-07 AT1G10690 92 / 2e-25 unknown protein Potri.017G070000 [exp] 44 / 1e-06 AT5G40460 89 / 3e-24 unknown protein Potri.008G187300 [exp] 42 / 4e-06 AT5G40460 97 / 3e-27 unknown protein Potri.010G231700 [exp] 37 / 0.0006 AT5G04470 / SIAMESE, cyclin-dependent protein kinase inhibitors (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014904 [exp] 56 / 1e-10 AT3G20898 61 / 1e-12 unknown protein Lus10038653 [exp] 40 / 3e-05 AT5G02420 47 / 2e-07 unknown protein Lus10004622 [exp] 40 / 5e-05 AT1G60783 51 / 9e-10 unknown protein Lus10026693 [exp] 38 / 0.0002 AT1G60783 47 / 5e-08 unknown protein Lus10040827 [exp] 38 / 0.0005 AT3G20898 44 / 8e-06 unknown protein Lus10037925 [exp] 37 / 0.0005 AT5G02420 47 / 2e-07 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G053600.1 pacid=42769544 polypeptide=Potri.006G053600.1.p locus=Potri.006G053600 ID=Potri.006G053600.1.v4.1 annot-version=v4.1 ATGGCACCGTCAAATAATACAAGAAGATCAACAAGATACAAGAGGCAAGAAGTTCTGACAAAACGTGATGAAACATCAAGGGATCTCCATTTTAGTCACA GCACTACTGCTACCAGCTCCAAAGAATCATGCAACGAGGGCATTGTTGGCTGTTCTACACCAAAGGCGCAAAGATTCAAAATACCCGAGACCCTATCTTG TCCACCAGCTCCGATGAAGAGAAGGGTAACTACAAAGTGCTCATCAAAGAAATCTCCCATAGCATTTTTCGCTTCTCCAGATATAGAGCTCTTCTTCTTC CTAGCATTTCACAATATCCCAACTTAA
AA sequence Show only first row Show all	>Potri.006G053600.1 pacid=42769544 polypeptide=Potri.006G053600.1.p locus=Potri.006G053600 ID=Potri.006G053600.1.v4.1 annot-version=v4.1 MAPSNNTRRSTRYKRQEVLTKRDETSRDLHFSHSTTATSSKESCNEGIVGCSTPKAQRFKIPETLSCPPAPMKRRVTTKCSSKKSPIAFFASPDIELFFF LAFHNIPT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G20898			unknown protein		Potri.006G053600 [exp]	0	1
AT1G79580	NAC	ANAC033, SMB, N...	NAC (No Apical Meristem) domai...		Potri.008G080000 [exp]	2.23	0.9567
					Potri.017G122100 [exp]	4.69	0.9523
AT3G14460			LRR and NB-ARC domains-contain...		Potri.003G200800 [exp]	8.24	0.9370
AT3G03280			unknown protein		Potri.017G121200 [exp]	9.64	0.9098
AT1G18590		SOT17, ATSOT17,...	ARABIDOPSIS SULFOTRANSFERASE 5...		Potri.011G048400 [exp]	9.79	0.9393
AT1G34110			Leucine-rich receptor-like pro...		Potri.002G063300 [exp]	13.49	0.9135
AT1G79580	NAC	ANAC033, SMB, N...	NAC (No Apical Meristem) domai...		Potri.010G176600 [exp]	14.14	0.9364
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.018G095900 [exp]	18.13	0.9342
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Potri.015G003600 [exp]	19.74	0.9247
AT1G05577			Domain of unknown function (DU...		Potri.009G024900 [exp]	20.04	0.9346

Compare expression of checked genes

Potri.006G053600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.