Plant FIBer expression Database

Potri.006G057100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57790 101 / 1e-26 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G051200
[exp]
114 / 2e-31 AT3G57790 642 / 0.0 Pectin lyase-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026318
[exp]
102 / 2e-26 AT3G57790 669 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10042350
[exp]
71 / 8e-16 AT3G57790 523 / 0.0 Pectin lyase-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.006G057100.2 pacid=42770362 polypeptide=Potri.006G057100.2.p locus=Potri.006G057100 ID=Potri.006G057100.2.v4.1 annot-version=v4.1
ATGGTGGGGAGAGCAGAGCCTATTATTTATGTGACAACCTGCGATACTGAGTTTCCAAAGAGGGTAATATCTAACCTACCATTCATCAACCTTACAGCGA
ATTCTGAAAATGGTGTCATCTTGTTAGGTTCTAAAGGTGGCCTACTGAGCAACCTGAGATTCAGTGGCATGAATCTGACTTGCAGAAGATGGGCAAATTA
TCCAGGTGGGTTGGTAGACTACAGACCTGGATGCCAGGATGTTGTTAATCACGGTGCAGCCGGGATCATCATGGAATATATCGAGGGCTTCGATCGAGGT
TGA
AA sequence
>Potri.006G057100.2 pacid=42770362 polypeptide=Potri.006G057100.2.p locus=Potri.006G057100 ID=Potri.006G057100.2.v4.1 annot-version=v4.1
MVGRAEPIIYVTTCDTEFPKRVISNLPFINLTANSENGVILLGSKGGLLSNLRFSGMNLTCRRWANYPGGLVDYRPGCQDVVNHGAAGIIMEYIEGFDRG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G57790 Pectin lyase-like superfamily ... Potri.006G057100
[exp]
0 1
AT4G32690 ATGLB3, GLB3 ARABIDOPSIS HEMOGLOBIN 3, hemo... Potri.018G036200
[exp]
12.64 0.6060
AT2G15880 Leucine-rich repeat (LRR) fami... Potri.004G146350
[exp]
13.45 0.6813
AT3G19940 Major facilitator superfamily ... Potri.007G073900
[exp]
38.14 0.6191
AT3G59850 Pectin lyase-like superfamily ... Potri.017G004701
[exp]
39.30 0.5888
AT1G43760 DNAse I-like superfamily prote... Potri.004G128860
[exp]
64.21 0.5219
AT5G02010 ATROPGEF7, ROPG... RHO guanyl-nucleotide exchange... Potri.002G068366
[exp]
105.31 0.5655
AT2G17080 Arabidopsis protein of unknown... Potri.004G182700
[exp]
162.74 0.5447

Potri.006G057100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.