Potri.006G057400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57810 307 / 6e-104 Cysteine proteinases superfamily protein (.1.2.3)
AT2G38025 70 / 1e-13 Cysteine proteinases superfamily protein (.1)
AT2G27350 43 / 0.0002 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G050900 533 / 0 AT3G57810 301 / 5e-101 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G177400 228 / 4e-75 AT3G57810 223 / 6e-74 Cysteine proteinases superfamily protein (.1.2.3)
Potri.010G234300 197 / 1e-60 AT3G57810 195 / 9e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G026100 196 / 3e-60 AT3G57810 197 / 2e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G110400 82 / 4e-18 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
Potri.010G057750 53 / 4e-09 AT3G57810 52 / 1e-09 Cysteine proteinases superfamily protein (.1.2.3)
Potri.009G160100 45 / 4e-05 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.004G196800 44 / 9e-05 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.005G140500 42 / 0.0004 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020438 396 / 1e-138 AT3G57810 290 / 3e-97 Cysteine proteinases superfamily protein (.1.2.3)
Lus10037002 215 / 5e-70 AT3G57810 213 / 2e-70 Cysteine proteinases superfamily protein (.1.2.3)
Lus10015803 215 / 5e-70 AT3G57810 215 / 3e-71 Cysteine proteinases superfamily protein (.1.2.3)
Lus10008986 182 / 3e-55 AT3G57810 187 / 9e-58 Cysteine proteinases superfamily protein (.1.2.3)
Lus10028840 185 / 5e-55 AT3G57810 194 / 4e-59 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027758 60 / 4e-10 AT2G38025 227 / 4e-75 Cysteine proteinases superfamily protein (.1)
Lus10040897 47 / 2e-05 AT3G62940 359 / 1e-124 Cysteine proteinases superfamily protein (.1.2.3)
Lus10006255 46 / 3e-05 AT5G67170 363 / 7e-124 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Lus10005193 44 / 0.0001 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10005939 43 / 0.0002 AT3G62940 363 / 9e-126 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.006G057400.9 pacid=42770618 polypeptide=Potri.006G057400.9.p locus=Potri.006G057400 ID=Potri.006G057400.9.v4.1 annot-version=v4.1
ATGATTGTTTGCTCTGCTATCAATACATGTGTGAAGAATGTTGTCCACCTGAGTGGCCGTGTTCAACAAATGGGCAGCACTATTTTGAATGTGGTGTCTA
GGGGACAATCCACTTCCCGCTGTTTTTCTTTGTACCCTAGTCGTTCCAGATCAAATTATTCTCGTTTGTCTGTCTCAAAGACATTCTCTTGTCCATCAAT
TAGCTTTCACACGTTGCATAGAAACTGTTTTGGATCCGACTCAATCAAGCAAAGGTATAATTTGGTATCATTAACTGTAAAAGGTGTAGTTAATTCTGGA
GGTCCTCTGAAGAGACAATTCAATATTTCATTGCCAAGCCAAAACATGGCTCTGAGGTTTTCAGTTTCGAAACGAGGACTGCTCGCCAAAATCAAGGGTA
ATGTGGGATCTGTTTCTTGTTCACAAAGACATACCACCACTGGTATATTTTTTGGTCTTCTGGTTTGTTATTCAAGTTCTGAGCCAACACATGCTGAATC
AGCTACTCGGAAGAACAAAGAAGAGGACATTTGCAATTCATCAGATATTAAATTCTCACATGGGAAGGAAGTCTACACTGACTATTCCATTATTGGAGTA
CCAGGAGATGGTAGATGTCTGTTCCGTTCCGTGGCTCATGGGGCTTGTTTACGGTTTGGGAAACGAGCTCCAAGTGAAAGCCTTCAGAGAGAATTAGCAG
ATGACTTGCGTTCTAAAGTTGCTGATGAGTTTATCAAGAGAAGGGAAGATACAGAATGGTTTATAGAAGGCAATTTTGACTCCTATGTGTCACAAATGAG
GAAGCCACATGTGTGGGGTGGTGAGCCTGAGTTGTTAATGGCTTCACATGTTCTCAAGATGCCAATCACTGTGTACATGCACGACAAGAATGCGAGGGGC
TTGATATCCATTGCAGAGTATGGTCAGGAGTATGGGGTGGAAAATCCAATTAGAGTTATATATAATGGATTTGGTCATTATGATGCCTTGCAATTTTCCT
GGAACCAGAGGCGGTAA
AA sequence
>Potri.006G057400.9 pacid=42770618 polypeptide=Potri.006G057400.9.p locus=Potri.006G057400 ID=Potri.006G057400.9.v4.1 annot-version=v4.1
MIVCSAINTCVKNVVHLSGRVQQMGSTILNVVSRGQSTSRCFSLYPSRSRSNYSRLSVSKTFSCPSISFHTLHRNCFGSDSIKQRYNLVSLTVKGVVNSG
GPLKRQFNISLPSQNMALRFSVSKRGLLAKIKGNVGSVSCSQRHTTTGIFFGLLVCYSSSEPTHAESATRKNKEEDICNSSDIKFSHGKEVYTDYSIIGV
PGDGRCLFRSVAHGACLRFGKRAPSESLQRELADDLRSKVADEFIKRREDTEWFIEGNFDSYVSQMRKPHVWGGEPELLMASHVLKMPITVYMHDKNARG
LISIAEYGQEYGVENPIRVIYNGFGHYDALQFSWNQRR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G57810 Cysteine proteinases superfami... Potri.006G057400 0 1
AT4G03500 Ankyrin repeat family protein ... Potri.019G108000 9.53 0.8027
AT4G10360 TRAM, LAG1 and CLN8 (TLC) lipi... Potri.019G133500 21.54 0.6865
AT5G53880 unknown protein Potri.011G117001 23.64 0.7582
AT1G01140 PKS6, CIPK9, Sn... SNF1-RELATED PROTEIN KINASE 3.... Potri.002G177900 26.83 0.7813
Potri.002G138100 37.94 0.7667
AT1G17840 AtABCG11, WBC11... DESPERADO, CUTICULAR DEFECT AN... Potri.018G152600 38.49 0.7749
AT3G17210 ATHS1 A. THALIANA HEAT STABLE PROTEI... Potri.010G150700 41.07 0.7716
AT2G28470 BGAL8 beta-galactosidase 8 (.1.2) Potri.011G044300 45.95 0.7649 GAL1.6
AT1G29740 Leucine-rich repeat transmembr... Potri.011G072866 47.27 0.7571
AT3G59420 ACR4 crinkly4 (.1) Potri.007G128400 51.18 0.7651 ACR4.3

Potri.006G057400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.