Potri.006G059900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G115550 97 / 2e-27 ND /
Potri.006G060000 65 / 2e-14 ND /
Potri.018G115601 64 / 6e-14 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008816 42 / 5e-06 ND /
Lus10038105 37 / 0.0008 ND /
PFAM info
Representative CDS sequence
>Potri.006G059900.1 pacid=42768781 polypeptide=Potri.006G059900.1.p locus=Potri.006G059900 ID=Potri.006G059900.1.v4.1 annot-version=v4.1
ATGAGGGCTTCTTTAGTAGTCTCTCTTCTGCTTATGCTCTTTCTCCTTCAAGAGGCTCAAGGGATTCGATTGGAAAAGGGGTTCATGCAAGTTGGAGCTC
AAAAGGTTCAGGCTGATCAGGATAACACTTCTTTGAAGCAAATTAGTACTGGGGTTCTTGGGGAAGAAGTCATTCTTTGCAAAGAAGGGCATTGTACAAG
TACCCTGAAGAAAAGACTTTCTAGATCAGTGTCCAAGAAATCTTCACATCACTGGTCACCAAGAATTCATGAAGATTACTGTGGACCTAGGCATCACAAA
CCGAGACACCATTAG
AA sequence
>Potri.006G059900.1 pacid=42768781 polypeptide=Potri.006G059900.1.p locus=Potri.006G059900 ID=Potri.006G059900.1.v4.1 annot-version=v4.1
MRASLVVSLLLMLFLLQEAQGIRLEKGFMQVGAQKVQADQDNTSLKQISTGVLGEEVILCKEGHCTSTLKKRLSRSVSKKSSHHWSPRIHEDYCGPRHHK
PRHH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G059900 0 1
AT5G43580 UPI UNUSUAL SERINE PROTEASE INHIBI... Potri.009G028300 2.44 0.9533
AT5G56970 ATCKX3, CKX3 cytokinin oxidase 3 (.1) Potri.007G066100 3.87 0.9507
AT1G64160 Disease resistance-responsive ... Potri.013G142401 4.89 0.9498
AT1G52820 2-oxoglutarate (2OG) and Fe(II... Potri.001G175800 7.48 0.9510
AT4G13580 Disease resistance-responsive ... Potri.001G054100 7.74 0.9486
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.014G152800 7.93 0.9461
AT1G64160 Disease resistance-responsive ... Potri.001G096560 8.36 0.9442
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G026032 8.48 0.9463
AT1G52790 2-oxoglutarate (2OG) and Fe(II... Potri.001G176000 11.48 0.9467 2OGox10
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G025900 16.97 0.9201

Potri.006G059900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.