Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11090 66 / 3e-14 serine-rich protein-related (.1) AT5G25280 59 / 1e-11 serine-rich protein-related (.1.2) AT5G20370 56 / 1e-10 serine-rich protein-related (.1) AT1G67910 43 / 1e-06 unknown protein AT1G24577 42 / 5e-06 unknown protein AT3G13227 41 / 1e-05 serine-rich protein-related (.1) AT5G55980 39 / 0.0001 serine-rich protein-related (.1) AT3G56500 37 / 0.0006 serine-rich protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G120300 [exp] 142 / 3e-45 AT5G11090 67 / 1e-14 serine-rich protein-related (.1) Potri.006G060800 [exp] 63 / 3e-13 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2) Potri.018G120400 [exp] 59 / 1e-11 AT5G11090 126 / 3e-36 serine-rich protein-related (.1) Potri.018G023300 [exp] 58 / 2e-11 AT5G11090 194 / 1e-62 serine-rich protein-related (.1) Potri.006G258600 [exp] 55 / 2e-10 AT5G25280 181 / 1e-57 serine-rich protein-related (.1.2) Potri.002G250700 [exp] 41 / 2e-05 AT3G56500 43 / 5e-06 serine-rich protein-related (.1) Potri.010G046700 [exp] 39 / 4e-05 AT1G67910 82 / 4e-22 unknown protein Potri.018G079200 [exp] 39 / 4e-05 AT1G67910 45 / 9e-08 unknown protein Potri.008G186200 [exp] 39 / 5e-05 AT1G67910 85 / 4e-23 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008811 [exp] 81 / 3e-21 AT5G11090 61 / 2e-12 serine-rich protein-related (.1) Lus10038101 [exp] 81 / 1e-20 AT5G11090 54 / 2e-09 serine-rich protein-related (.1) Lus10008808 [exp] 71 / 3e-16 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2) Lus10039998 [exp] 71 / 3e-16 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2) Lus10038100 [exp] 68 / 9e-15 AT5G25280 145 / 4e-43 serine-rich protein-related (.1.2) Lus10006660 [exp] 67 / 9e-15 AT5G25280 144 / 4e-43 serine-rich protein-related (.1.2) Lus10001946 [exp] 63 / 4e-13 AT5G11090 179 / 9e-57 serine-rich protein-related (.1) Lus10001928 [exp] 59 / 2e-11 AT5G11090 177 / 3e-56 serine-rich protein-related (.1) Lus10034901 [exp] 43 / 2e-06 AT1G67910 49 / 6e-09 unknown protein Lus10023632 [exp] 42 / 3e-06 AT1G67910 48 / 1e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G060700.1 pacid=42767888 polypeptide=Potri.006G060700.1.p locus=Potri.006G060700 ID=Potri.006G060700.1.v4.1 annot-version=v4.1 ATGGCATCTAGAGACGTACCTTATCCTAGGTCAAATGCGCAGCAACAAGCCAGGACATGCCTATGTTCACCCACCACACATCCTGGATCATTCAGGTGCA GCCTGCACAGGAATTTCCGTAAGGTGTCTTCAGGATCAAGAATCGGTCGTGTTGGGTCGAATCATAATTGGGACTTGACTGTGGTTGCCAAAGCGAATCC GTTCAAGGCAATCTTGTTACAGATTATCAAGCCAACCAGTCATGACCTTCACAGGAGGAGGGATTTCCAGCCCAGGCCTACCAGGTTTTGCCTAATGAAT GCTAATAGAAATGGGGTTGCTGTTTCTTGA
AA sequence Show only first row Show all	>Potri.006G060700.1 pacid=42767888 polypeptide=Potri.006G060700.1.p locus=Potri.006G060700 ID=Potri.006G060700.1.v4.1 annot-version=v4.1 MASRDVPYPRSNAQQQARTCLCSPTTHPGSFRCSLHRNFRKVSSGSRIGRVGSNHNWDLTVVAKANPFKAILLQIIKPTSHDLHRRRDFQPRPTRFCLMN ANRNGVAVS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G11090			serine-rich protein-related (....		Potri.006G060700 [exp]	0	1
AT1G69800			Cystathionine beta-synthase (C...		Potri.017G053600 [exp]	14.49	0.7893
AT1G28270		RALFL4	ralf-like 4 (.1)		Potri.004G045000 [exp]	24.97	0.7470
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Potri.003G218000 [exp]	28.70	0.7510
AT5G52340		ATEXO70A2	exocyst subunit exo70 family p...		Potri.006G203900 [exp]	32.00	0.7216
AT4G30420			nodulin MtN21 /EamA-like trans...		Potri.006G177700 [exp]	36.93	0.7321
AT1G51550			Kelch repeat-containing F-box ...		Potri.008G006300 [exp]	41.10	0.7486
AT1G29290			unknown protein		Potri.011G108101 [exp]	44.86	0.6983
AT4G21020			Late embryogenesis abundant pr...		Potri.004G046000 [exp]	44.89	0.6960	Pt-PM32.1
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.004G069700 [exp]	45.98	0.7410
					Potri.012G100900 [exp]	50.49	0.7081

Compare expression of checked genes

Potri.006G060700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.