Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58190 82 / 3e-18 AtRLP9 receptor like protein 9 (.1.2) AT1G75820 81 / 5e-18 ATCLV1, FLO5, FAS3, CLV1 FLOWER DEVELOPMENT 5, FASCIATA 3, CLAVATA 1, Leucine-rich receptor-like protein kinase family protein (.1) AT3G47580 79 / 4e-17 Leucine-rich repeat protein kinase family protein (.1) AT5G62230 74 / 2e-15 ERL1 ERECTA-like 1 (.1.2) AT1G74190 72 / 1e-14 AtRLP15 receptor like protein 15 (.1) AT4G20940 71 / 2e-14 Leucine-rich receptor-like protein kinase family protein (.1) AT3G47090 71 / 3e-14 Leucine-rich repeat protein kinase family protein (.1) AT5G49290 71 / 3e-14 ATRLP56 receptor like protein 56 (.1) AT2G25470 68 / 2e-13 AtRLP21 receptor like protein 21 (.1) AT2G26330 68 / 2e-13 QRP1, ER QUANTITATIVE RESISTANCE TO PLECTOSPHAERELLA 1, ERECTA, Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G061000 [exp] 275 / 5e-87 AT1G74190 286 / 4e-82 receptor like protein 15 (.1) Potri.006G061300 [exp] 184 / 4e-54 AT2G25470 333 / 4e-99 receptor like protein 21 (.1) Potri.018G117927 [exp] 127 / 4e-34 AT1G07390 429 / 3e-132 receptor like protein 1 (.1.2.3) Potri.018G145516 [exp] 122 / 2e-32 AT1G74190 346 / 1e-103 receptor like protein 15 (.1) Potri.018G144300 [exp] 122 / 4e-32 AT2G25470 348 / 8e-105 receptor like protein 21 (.1) Potri.001G065327 [exp] 120 / 1e-31 AT1G07390 352 / 3e-105 receptor like protein 1 (.1.2.3) Potri.001G063300 [exp] 120 / 2e-31 AT1G07390 330 / 1e-96 receptor like protein 1 (.1.2.3) Potri.001G065300 [exp] 119 / 3e-31 AT1G58190 390 / 4e-120 receptor like protein 9 (.1.2) Potri.018G144800 [exp] 116 / 3e-30 AT1G74170 284 / 1e-81 receptor like protein 13 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030068 [exp] 97 / 2e-23 AT5G49290 397 / 3e-124 receptor like protein 56 (.1) Lus10027856 [exp] 79 / 3e-17 AT1G74190 272 / 1e-77 receptor like protein 15 (.1) Lus10030638 [exp] 75 / 1e-15 AT3G47570 771 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030845 [exp] 73 / 6e-15 AT3G47570 796 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10004388 [exp] 72 / 1e-14 AT3G47570 815 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030847 [exp] 72 / 1e-14 AT3G47570 746 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10038598 [exp] 72 / 1e-14 AT3G47570 671 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030855 [exp] 70 / 5e-14 AT3G47570 790 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10007287 [exp] 70 / 5e-14 AT5G45800 657 / 0.0 maternal effect embryo arrest 62, Leucine-rich repeat protein kinase family protein (.1) Lus10042381 [exp] 69 / 8e-14 AT1G74190 289 / 1e-82 receptor like protein 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [poplar] [flax] LRR PF13855 [poplar] [flax] LRR_8 Leucine rich repeat
Representative CDS sequence Show only first row Show all	>Potri.006G061250.1 pacid=42769275 polypeptide=Potri.006G061250.1.p locus=Potri.006G061250 ID=Potri.006G061250.1.v4.1 annot-version=v4.1 ATGAGATTGACAAATTTGTGTTATCCAAAGCTGTCCCCTGCAGATACTAGAGGTTTTGGAAATGTAAGCCTCATTTCATTATCTAATAGCACCTCAAATG GAAGAGCTCTTCCATTTACATTGCTGCAATCGTTAACGAAATTCCCAAACCTCAGGACCCTTAATTTGGATGAGAATAATCTTGAAGGAAGTTTCGGAAC AACATTAGATAAAGACTTGGCTTCTCTCAAGAATTTAGAAAAGTTGGATTTGAGTTTCTCCACTGTCGATAATAGCTTTCTGCAAACAGTCGGGAAGATT ACTACTCTAAAGAGTTTACGCTTGAGGGGCTGTCGACTCAATGGCTCCATCCCTAAAGCCCAAGGCCTATGTCAGTTAAAGCATCTCCAAAATCTAGATA TCAGTGGGAATGATCTCAGTGGTGCTTTGCCTCGGTGTTTGGCAAATTTGACATCCCTTCAAGGATTAGATTTGTCTTACAATAACTTTATTGGAGACAT TTCCTTCTCCCTCTTACAAGTCTCACATCCATCCGAGGGTTATCACTTTCAGACAACCACTTTCAGATCCCCGTCTCATTGA
AA sequence Show only first row Show all	>Potri.006G061250.1 pacid=42769275 polypeptide=Potri.006G061250.1.p locus=Potri.006G061250 ID=Potri.006G061250.1.v4.1 annot-version=v4.1 MRLTNLCYPKLSPADTRGFGNVSLISLSNSTSNGRALPFTLLQSLTKFPNLRTLNLDENNLEGSFGTTLDKDLASLKNLEKLDLSFSTVDNSFLQTVGKI TTLKSLRLRGCRLNGSIPKAQGLCQLKHLQNLDISGNDLSGALPRCLANLTSLQGLDLSYNNFIGDISFSLLQVSHPSEGYHFQTTTFRSPSH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G58190		AtRLP9	receptor like protein 9 (.1.2)		Potri.006G061250 [exp]	0	1
					Potri.004G202433 [exp]	19.49	0.8452
AT2G28690			Protein of unknown function (D...		Potri.006G256801 [exp]	60.44	0.8023
AT4G28670			Protein kinase family protein ...		Potri.007G056000 [exp]	108.09	0.8118
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Potri.003G057250 [exp]	121.04	0.7991
					Potri.002G056400 [exp]	125.44	0.8295
AT1G04770			Tetratricopeptide repeat (TPR)...		Potri.009G033201 [exp]	128.70	0.8260
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.018G133901 [exp]	138.70	0.8074
					Potri.001G076350 [exp]	150.00	0.8072
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.016G022250 [exp]	193.39	0.8102
AT5G49360		ATBXL1, BXL1	beta-xylosidase 1 (.1)		Potri.010G141400 [exp]	208.54	0.7843	Pt-BXL1.2

Compare expression of checked genes

Potri.006G061250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.