Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48675 48 / 5e-08 Protein of unknown function (DUF1278) (.1) AT5G54062 46 / 5e-07 unknown protein AT2G27315 44 / 1e-06 Protein of unknown function (DUF1278) (.1) AT5G36390 42 / 1e-05 ECA1 gametogenesis related family protein (.1) AT5G36380 42 / 1e-05 ECA1 gametogenesis related family protein (.1) AT5G36350 42 / 1e-05 ECA1 gametogenesis related family protein (.1) AT5G36360 42 / 1e-05 ECA1 gametogenesis related family protein (.1) AT5G36470 42 / 1e-05 ECA1 gametogenesis related family protein (.1) AT5G36460 42 / 1e-05 ECA1 gametogenesis related family protein (.1) AT5G36400 42 / 1e-05 ECA1 gametogenesis related family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G306600 [exp] 52 / 1e-09 AT2G21740 112 / 7e-33 Protein of unknown function (DUF1278) (.1) Potri.009G077000 [exp] 39 / 0.0001 AT1G76750 127 / 6e-38 Protein of unknown function (DUF1278) (.1) Potri.001G306700 [exp] 37 / 0.0006 AT1G76750 113 / 3e-33 Protein of unknown function (DUF1278) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008821 [exp] 48 / 1e-07 AT5G54062 47 / 2e-06 unknown protein Lus10004548 [exp] 39 / 0.0001 AT1G76750 130 / 4e-39 Protein of unknown function (DUF1278) (.1) Lus10004598 [exp] 38 / 0.0005 AT1G76750 131 / 2e-39 Protein of unknown function (DUF1278) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF05617 [poplar] [flax] Prolamin_like Prolamin-like
Representative CDS sequence Show only first row Show all	>Potri.006G062100.1 pacid=42768229 polypeptide=Potri.006G062100.1.p locus=Potri.006G062100 ID=Potri.006G062100.1.v4.1 annot-version=v4.1 ATGTCAACACAGACCATAGCAATTTTGTTGGCATTTTTGTGCATGGGAACGTTGATCCCATCTGGGTTAGCCCAGAAAATTCCAACACTTCCATGCTTTT TACCTCTCACAACTATACCAGGGTGCTCTAAGGAAATTTTTGTGGCCATTTCCGCTGGCACTGGCCGTATCGCCATCGGTCCTGCTTGTTGCAAAGTCAT CAATGAGCTTACCGACGTCTGTTGGGCTCGACTGTTTCCTTCCATACCTGCCACCGGTAAGTTTCTTAGAGGCATCTGTTCTCGTAGTGGAATCAGCCCT GCTCCGGCGCCGGCGCCTAATTAA
AA sequence Show only first row Show all	>Potri.006G062100.1 pacid=42768229 polypeptide=Potri.006G062100.1.p locus=Potri.006G062100 ID=Potri.006G062100.1.v4.1 annot-version=v4.1 MSTQTIAILLAFLCMGTLIPSGLAQKIPTLPCFLPLTTIPGCSKEIFVAISAGTGRIAIGPACCKVINELTDVCWARLFPSIPATGKFLRGICSRSGISP APAPAPN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G48675			Protein of unknown function (D...		Potri.006G062100 [exp]	0	1
AT3G49190			O-acyltransferase (WSD1-like) ...		Potri.017G010700 [exp]	1.41	0.9948
AT5G02890			HXXXD-type acyl-transferase fa...		Potri.001G152500 [exp]	4.69	0.9806
AT1G24470		ATKCR2, KCR2	beta-ketoacyl reductase 2 (.1)		Potri.008G181600 [exp]	4.69	0.9851
AT5G46690	bHLH	bHLH071	beta HLH protein 71 (.1)		Potri.003G093200 [exp]	6.00	0.9904
AT4G30610		SCPL24, BRS1	SERINE CARBOXYPEPTIDASE 24 PRE...		Potri.018G105700 [exp]	6.48	0.9829	BRS1.1
AT3G05660		AtRLP33	receptor like protein 33 (.1)		Potri.012G029000 [exp]	9.48	0.9893
AT1G64780		ATAMT1;2	ammonium transporter 1;2 (.1)		Potri.009G045200 [exp]	11.09	0.9916	6
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Potri.010G080333 [exp]	11.66	0.9870
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.012G008666 [exp]	13.41	0.9851
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.016G020700 [exp]	13.74	0.9861

Compare expression of checked genes

Potri.006G062100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.