Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20400 129 / 7e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G54000 124 / 5e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G20550 121 / 6e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G49390 116 / 6e-31 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25300 81 / 1e-17 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G17010 75 / 9e-16 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 75 / 1e-15 ATSRG1, SRG1 senescence-related gene 1 (.1) AT2G38240 74 / 3e-15 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25310 73 / 4e-15 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 67 / 4e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G062500 [exp] 160 / 1e-47 AT5G20400 432 / 2e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G121700 [exp] 158 / 5e-47 AT5G20400 426 / 8e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G121800 [exp] 151 / 4e-44 AT5G54000 407 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G030400 [exp] 134 / 2e-37 AT1G49390 320 / 2e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G030500 [exp] 125 / 2e-34 AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G030451 [exp] 125 / 2e-34 AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G200900 [exp] 84 / 9e-19 AT3G21420 288 / 4e-95 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G121750 [exp] 77 / 2e-18 AT1G49390 107 / 1e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G201000 [exp] 81 / 7e-18 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008824 [exp] 128 / 3e-35 AT1G49390 410 / 2e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10039975 [exp] 109 / 2e-28 AT1G49390 309 / 5e-104 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10008826 [exp] 104 / 2e-26 AT1G49390 298 / 1e-99 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016145 [exp] 92 / 9e-22 AT5G20550 225 / 2e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10006518 [exp] 72 / 2e-14 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10004387 [exp] 71 / 3e-14 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004808 [exp] 71 / 4e-14 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10026173 [exp] 69 / 2e-13 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1) Lus10035702 [exp] 67 / 7e-13 AT4G16330 347 / 4e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10030185 [exp] 65 / 3e-12 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Potri.006G062400.2 pacid=42769016 polypeptide=Potri.006G062400.2.p locus=Potri.006G062400 ID=Potri.006G062400.2.v4.1 annot-version=v4.1 ATGGGATGTCAAGTTCATTCCTCGAAATTGCACGTCATTGTTTTTTGCATTACAGTGGAAGAGAAGCAGAAATACGCCAGGGCAGTGAATGGAAGTGAAG GGACAGTTTCGAAAAAAGATTTAAGAAGGATAAATCTGTGTCCAGAAAATCCAAATGATTTCAGAGAGATCTTCCACGAATACGCAGTGAGATTAAAAAT AGAAAGCTTTTCAGACCAGTTTGGTGACAGAGGATTGGTGAGAGGAATGTTCAATTTCTATCCAAGGTGTTCTAGACCTGATCTTGTTCTTGGTGTAAAG CCTCGTAGTGATAGGTCAGGCATAACAGTTCTGCTGCAAGACAGAGAAGTGGAAGGACTTCAAATAATGAGTGATGGGATGTTCAGAAGTCCATTGCTAC GGGTAGTAACGAACTCAGAATTATATAAATTATATCTTGAGATCTCATCTAATAATTTAAACCCAGAAAAAGATATTGGCCCAGTGGATTGCTTGGTGGA TGAGCAAAGACCAAGACTATACAGAAATGTTAAAAATTATGGCCTCATCTACTATGAGTGGCACCAGAAAGGCAATGTTGCAATTGACACAGAAATGTTA AAAATTATGGCCTCATCTACTATGAGTGGCACCAGAAAGGCAATGTTGCAATTGACACGCTAA
AA sequence Show only first row Show all	>Potri.006G062400.2 pacid=42769016 polypeptide=Potri.006G062400.2.p locus=Potri.006G062400 ID=Potri.006G062400.2.v4.1 annot-version=v4.1 MGCQVHSSKLHVIVFCITVEEKQKYARAVNGSEGTVSKKDLRRINLCPENPNDFREIFHEYAVRLKIESFSDQFGDRGLVRGMFNFYPRCSRPDLVLGVK PRSDRSGITVLLQDREVEGLQIMSDGMFRSPLLRVVTNSELYKLYLEISSNNLNPEKDIGPVDCLVDEQRPRLYRNVKNYGLIYYEWHQKGNVAIDTEML KIMASSTMSGTRKAMLQLTR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20400			2-oxoglutarate (2OG) and Fe(II...		Potri.006G062400 [exp]	0	1
AT5G10620			methyltransferases (.1)		Potri.006G278500 [exp]	9.53	0.8613
AT4G05440		EDA35	embryo sac development arrest ...		Potri.017G048600 [exp]	17.02	0.8519
AT1G67025			unknown protein		Potri.017G117230 [exp]	21.44	0.8727
AT1G65420		NPQ7	NONPHOTOCHEMICAL QUENCHING 7, ...		Potri.008G076900 [exp]	23.62	0.8624
AT3G13160			Tetratricopeptide repeat (TPR)...		Potri.004G030000 [exp]	26.15	0.8335
AT3G13800			Metallo-hydrolase/oxidoreducta...		Potri.003G036800 [exp]	32.24	0.7963
AT1G79810		PEX2, TED3, ATP...	ARABIDOPSIS PEROXIN 2, Pex2/Pe...		Potri.001G186000 [exp]	32.83	0.8508	Pt-TED3.2
AT3G59780			Rhodanese/Cell cycle control p...		Potri.019G098950 [exp]	34.29	0.8491
AT3G20800			Cell differentiation, Rcd1-lik...		Potri.001G359300 [exp]	34.40	0.7581
AT4G28820			HIT-type Zinc finger family pr...		Potri.002G252700 [exp]	34.89	0.8059

Compare expression of checked genes

Potri.006G062400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.