Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20260 147 / 6e-44 Exostosin family protein (.1) AT3G42180 140 / 3e-41 Exostosin family protein (.1.3) AT5G33290 131 / 1e-37 XGD1 xylogalacturonan deficient 1 (.1) AT5G11130 129 / 7e-37 Exostosin family protein (.1) AT5G03795 116 / 6e-32 Exostosin family protein (.1) AT3G07620 114 / 4e-31 Exostosin family protein (.1) AT4G16745 112 / 2e-30 Exostosin family protein (.1.2) AT5G11610 105 / 8e-28 Exostosin family protein (.1.2) AT5G25310 100 / 4e-26 Exostosin family protein (.1) AT4G32790 99 / 1e-25 Exostosin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G064800 [exp] 192 / 2e-60 AT5G20260 556 / 0.0 Exostosin family protein (.1) Potri.018G125058 [exp] 178 / 4e-55 AT5G20260 526 / 0.0 Exostosin family protein (.1) Potri.T124707 [exp] 178 / 4e-55 AT5G20260 526 / 0.0 Exostosin family protein (.1) Potri.006G064900 [exp] 173 / 1e-53 AT5G20260 530 / 0.0 Exostosin family protein (.1) Potri.018G124945 [exp] 166 / 6e-51 AT5G20260 548 / 0.0 Exostosin family protein (.1) Potri.T124607 [exp] 165 / 2e-50 AT5G20260 545 / 0.0 Exostosin family protein (.1) Potri.006G064700 [exp] 164 / 7e-50 AT5G20260 563 / 0.0 Exostosin family protein (.1) Potri.006G064600 [exp] 144 / 1e-42 AT5G20260 543 / 0.0 Exostosin family protein (.1) Potri.018G124832 [exp] 142 / 1e-41 AT3G42180 524 / 0.0 Exostosin family protein (.1.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005186 [exp] 140 / 8e-41 AT5G20260 513 / 3e-180 Exostosin family protein (.1) Lus10027707 [exp] 139 / 2e-40 AT5G20260 526 / 0.0 Exostosin family protein (.1) Lus10039142 [exp] 134 / 3e-38 AT5G03795 603 / 0.0 Exostosin family protein (.1) Lus10013790 [exp] 132 / 9e-38 AT5G03795 602 / 0.0 Exostosin family protein (.1) Lus10039980 [exp] 130 / 6e-37 AT5G20260 489 / 2e-169 Exostosin family protein (.1) Lus10025178 [exp] 120 / 2e-33 AT5G03795 471 / 5e-163 Exostosin family protein (.1) Lus10016058 [exp] 116 / 7e-33 AT5G03795 439 / 1e-152 Exostosin family protein (.1) Lus10001917 [exp] 115 / 2e-31 AT5G25310 499 / 3e-174 Exostosin family protein (.1) Lus10001958 [exp] 110 / 9e-31 AT5G25310 372 / 1e-127 Exostosin family protein (.1) Lus10008751 [exp] 107 / 2e-28 AT3G07620 542 / 0.0 Exostosin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03016 [poplar] [flax] Exostosin Exostosin family
Representative CDS sequence Show only first row Show all	>Potri.006G064850.1 pacid=42767287 polypeptide=Potri.006G064850.1.p locus=Potri.006G064850 ID=Potri.006G064850.1.v4.1 annot-version=v4.1 ATGGGTCAAAGCAAGTTTTGCTTGTGCCCAAGCGGGCATGAAGTAGCAAGTCCTAGAGTGGTAACAGCAATTCAATTGGGATGTGTTCCTGTGACCATCT CCGATAACTATTCATTGCCATTTAGTGATGTTCTTGATTGGAGCAAGTTCTCTGTTGACATTCCGTCGGAAAAGATACCTGATATTAAGATAATTTTGAA AGGAATTTCGGTTCGACGGTATTTTACAATGCAAAGAAGAGTGATGCAAATTCGAAGACATTTCACGTTGAATCGACCTGACATTTCACGTTGA
AA sequence Show only first row Show all	>Potri.006G064850.1 pacid=42767287 polypeptide=Potri.006G064850.1.p locus=Potri.006G064850 ID=Potri.006G064850.1.v4.1 annot-version=v4.1 MGQSKFCLCPSGHEVASPRVVTAIQLGCVPVTISDNYSLPFSDVLDWSKFSVDIPSEKIPDIKIILKGISVRRYFTMQRRVMQIRRHFTLNRPDISR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20260			Exostosin family protein (.1)		Potri.006G064850 [exp]	0	1
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Potri.007G003000 [exp]	4.89	0.8331
AT4G00210	AS2	LBD31	LOB domain-containing protein ...		Potri.002G148900 [exp]	5.19	0.8336
AT1G22540			Major facilitator superfamily ...		Potri.019G079551 [exp]	6.32	0.8162
AT2G40460			Major facilitator superfamily ...		Potri.019G055800 [exp]	9.79	0.7874
AT3G13540	MYB	ATMYB5, ATM2	myb domain protein 5 (.1)		Potri.006G221200 [exp]	10.58	0.7839
AT5G43150			unknown protein		Potri.001G037400 [exp]	13.56	0.7822
AT4G30470			NAD(P)-binding Rossmann-fold s...		Potri.006G178700 [exp]	14.07	0.7365
AT1G22540			Major facilitator superfamily ...		Potri.013G107050 [exp]	15.16	0.7259
AT1G05630		AT5PTASE13, 5PT...	Endonuclease/exonuclease/phosp...		Potri.017G006900 [exp]	21.02	0.7360
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Potri.014G038000 [exp]	21.67	0.7761

Compare expression of checked genes

Potri.006G064850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.